DnaK suppressor protein (dksA) Recombinant Protein | dksA recombinant protein

Recombinant Escherichia coli DnaK suppressor protein (dksA)

Cat. Num. AAA1211011

• Gene Names: dksA; ECK0144; JW0141; msmA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DnaK suppressor protein (dksA); Recombinant Escherichia coli DnaK suppressor protein (dksA); dksA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-151, full length protein
• Sequence: MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG
• Sequence Length: 151

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16128138
• NCBI GeneID: 944850
• NCBI Accession #: NP_414687.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0ABS1; P18274
• Molecular Weight: 17,528 Da
• NCBI Official Full Name: transcriptional regulator of rRNA transcription; DnaK suppressor protein
• NCBI Official Symbol: dksA
• NCBI Official Synonym Symbols: ECK0144; JW0141; msmA
• NCBI Protein Information: transcriptional regulator of rRNA transcription; DnaK suppressor protein
• UniProt Protein Name: RNA polymerase-binding transcription factor DksA
• Protein Family: RNA polymerase-binding transcription factor
• UniProt Gene Name: dksA

NCBI Description

High copy dksA suppresses mukB and TS growth and filamentation of a dnaK mutant. dksA is also a multicopy suppressor of dnaJ, grpE and prc. dksA transcription is alkali-inducible. [More information is available at EcoGene: EG10230]. The DksA protein binds directly to RNA polymerase, affecting transcript elongation and augmenting the effect of the alarmone ppGpp on transcription initiation . [More information is available at EcoCyc: EG10230].

Uniprot Description

Transcription factor that acts by binding directly to the RNA polymerase (RNAP). Required for negative regulation of rRNA expression and positive regulation of several amino acid biosynthesis promoters. Also required for regulation of fis expression. Binding to RNAP disrupts interaction of RNAP with DNA, inhibits formation of initiation complexes, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription. Inhibits transcript elongation, exonucleolytic RNA cleavage and pyrophosphorolysis, and increases intrinsic termination. Also involved, with RecN, in repair of DNA double-strand breaks. Required, probably upstream of the two-component system BarA-UvrY, for expression of CsrA-antagonistic small RNAs CsrB and CsrC (PubMed:21488981).