Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome c1, heme protein (CYC1) Recombinant Protein | CYC1 recombinant protein

Recombinant Human Cytochrome c1, heme protein, mitochondrial (CYC1)

Gene Names
CYC1; UQCR4; MC3DN6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c1; heme protein (CYC1); Recombinant Human Cytochrome c1; heme protein; mitochondrial (CYC1); CYC1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
85-325aa; Full length protein
Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDE AKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRAR HGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMS QIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP K
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CYC1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,422 Da
NCBI Official Full Name
cytochrome c1, heme protein, mitochondrial
NCBI Official Synonym Full Names
cytochrome c1
NCBI Official Symbol
CYC1
NCBI Official Synonym Symbols
UQCR4; MC3DN6
NCBI Protein Information
cytochrome c1, heme protein, mitochondrial
UniProt Protein Name
Cytochrome c1, heme protein, mitochondrial
Protein Family
UniProt Gene Name
CYC1
UniProt Synonym Gene Names
Cytochrome c-1
UniProt Entry Name
CY1_HUMAN

NCBI Description

This gene encodes a subunit of the cytochrome bc1 complex, which plays an important role in the mitochondrial respiratory chain by transferring electrons from the Rieske iron-sulfur protein to cytochrome c. Mutations in this gene may cause mitochondrial complex III deficiency, nuclear type 6. [provided by RefSeq, Dec 2013]

Uniprot Description

CYC1: This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain. Belongs to the cytochrome c family.

Protein type: Oxidoreductase; Mitochondrial; Energy Metabolism - oxidative phosphorylation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion; nucleus

Molecular Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; heme binding; metal ion binding

Biological Process: mitochondrial electron transport, ubiquinol to cytochrome c; response to glucagon stimulus

Disease: Mitochondrial Complex Iii Deficiency, Nuclear Type 6

Research Articles on CYC1

Similar Products

Product Notes

The CYC1 cyc1 (Catalog #AAA7013390) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 85-325aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CYC1 cyc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDLELHPPSY PWSHRGLLSS LDHTSIRRGF QVYKQVCASC HSMDFVAYRH LVGVCYTEDE AKELAAEVEV QDGPNEDGEM FMRPGKLFDY FPKPYPNSEA ARAANNGALP PDLSYIVRAR HGGEDYVFSL LTGYCEPPTG VSLREGLYFN PYFPGQAIAM APPIYTDVLE FDDGTPATMS QIAKDVCTFL RWASEPEHDH RKRMGLKMLM MMALLVPLVY TIKRHKWSVL KSRKLAYRPP K. It is sometimes possible for the material contained within the vial of "Cytochrome c1, heme protein (CYC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.