Complement decay-accelerating factor (CD55) Recombinant Protein | CD55 recombinant protein

Recombinant Human Complement decay-accelerating factor (CD55), partial

Cat. Num. AAA9018470

• Gene Names: CD55; CR; TC; DAF; CROM
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Complement decay-accelerating factor (CD55); Recombinant Human Complement decay-accelerating factor (CD55); partial; Complement decay-accelerating factor(CD antigen CD55); CD55 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 35-126aa, Partial of Isoform 2
• Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE

• Species: Homo sapiens (Human)
• Relevance: This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade (PubMed:7525274). Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage (PubMed:28657829).; (Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5.; (Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable).; (Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for CD55 recombinant protein

Immunology

References

"Human rhinovirus 87 and enterovirus 68 represent a unique serotype with rhinovirus and enterovirus features."Blomqvist S., Savolainen C., Raman L., Roivainen M., Hovi T.J. Clin. Microbiol. 40:4218-4223(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 10835143
• NCBI GeneID: 1604
• NCBI Accession #: NP_000565.1
• NCBI GenBank Nucleotide #: NM_000574.3
• UniProt Accession #: P08174; P09679; P78361; B1AP14; D3DT83; D3DT84
• Molecular Weight: 41,400 Da
• NCBI Official Full Name: complement decay-accelerating factor isoform 1 preproprotein
• NCBI Official Synonym Full Names: CD55 molecule, decay accelerating factor for complement (Cromer blood group)
• NCBI Official Symbol: CD55
• NCBI Official Synonym Symbols: CR; TC; DAF; CROM
• NCBI Protein Information: complement decay-accelerating factor; CD55 antigen
• UniProt Protein Name: Complement decay-accelerating factor
• Protein Family: Complement decay-accelerating factor
• UniProt Gene Name: CD55
• UniProt Synonym Gene Names: CR; DAF
• UniProt Entry Name: DAF_HUMAN

NCBI Description

This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

CD55: This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Belongs to the receptors of complement activation (RCA) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell surface

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: cell surface; integral to plasma membrane; extracellular region; plasma membrane; lipid raft

Molecular Function: viral receptor activity; protein binding; lipid binding

Biological Process: respiratory burst; entry of virus into host cell; elevation of cytosolic calcium ion concentration; negative regulation of complement activation; regulation of complement activation; innate immune response; regulation of lipopolysaccharide-mediated signaling pathway; complement activation, classical pathway

Disease: Blood Group, Cromer System