Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

B-cell receptor CD22 (CD22) Recombinant Protein | CD22 recombinant protein

Recombinant Human B-cell receptor CD22 (CD22), partial

Gene Names
CD22; SIGLEC2; SIGLEC-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
B-cell receptor CD22 (CD22); Recombinant Human B-cell receptor CD22 (CD22); partial; B-lymphocyte cell adhesion molecule (BL-CAM)(Sialic acid-binding Ig-like lectin 2)(Siglec-2)(T-cell surface antigen Leu-14)(CD22); CD22 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
553-672aa, Partial
Sequence
ESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPL
Species
Homo sapiens (Human)
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for CD22 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
933
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
95,348 Da
NCBI Official Full Name
B-cell receptor CD22 isoform 2
NCBI Official Synonym Full Names
CD22 molecule
NCBI Official Symbol
CD22
NCBI Official Synonym Symbols
SIGLEC2; SIGLEC-2
NCBI Protein Information
B-cell receptor CD22; BL-CAM; CD22 antigen; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2
UniProt Protein Name
B-cell receptor CD22
Protein Family
UniProt Gene Name
CD22
UniProt Synonym Gene Names
SIGLEC2; BL-CAM; Siglec-2
UniProt Entry Name
CD22_HUMAN

Uniprot Description

CD22: Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: integral to plasma membrane; external side of plasma membrane

Molecular Function: protein binding; carbohydrate binding

Biological Process: cell adhesion

Research Articles on CD22

Similar Products

Product Notes

The CD22 cd22 (Catalog #AAA950805) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 553-672aa, Partial. The amino acid sequence is listed below: ESQLNFDSIS PEDAGSYSCW VNNSIGQTAS KAWTLEVLYA PRRLRVSMSP GDQVMEGKSA TLTCESDANP PVSHYTWFDW NNQSLPYHSQ KLRLEPVKVQ HSGAYWCQGT NSVGKGRSPL. It is sometimes possible for the material contained within the vial of "B-cell receptor CD22 (CD22), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.