Complement component C8 beta chain (C8b) Recombinant Protein | C8b recombinant protein
Recombinant Mouse Complement component C8 beta chain (C8b)
Gene Names
C8b; AI595927; 4930439B20Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement component C8 beta chain (C8b); Recombinant Mouse Complement component C8 beta chain (C8b); C8b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
54-589, Full length protein
Sequence
SVAEAPAPIDCELSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDLSDKEVEDCVTNQPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKNCQREMEQYWAIDRLASGINLFTNTFEGPVLDHRYYAGGCSPHYILDTNFRKPYNVESYTPQTKCEYEFTLTEYESYSDFERLVIEKKTHMFNFTSGFKVDGVMDLGIKVESNEGKNYVTRTKRFAHTQSKFLHARSVLEVAHYKLKSRSLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMNKDAMEQGDYTLSHVTACAGGSFGIGGMVYKVYVKVGVSAKKCSDIMKEINERNKRSTMVEDLVVLVRGGTSEDITALAYKELPTPELMEAWGDAVKYNPAIIKIKAEPLYELVTATDFAYSSTVKQNLKKALEEFQSEVSSCRCAPCRGNGVPVLKGSRCECICPGGFQGTACEVTYRKDIPIDGKWSCWSDWSACSGGHKTRHRQCNNPAPHKGGSPCSGPASETLNC
Sequence Length
536
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for C8b recombinant protein
C8 beta is one of the three subunits that comprise the component 8 (C8) of the complement system. C8 participates in the formation of Membrane Attack Complex that results in the lysis of cells. Patients with C8B deficiency are prone to bacteria infection.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58,450 Da
NCBI Official Full Name
complement component C8 beta chain isoform 2
NCBI Official Synonym Full Names
complement component 8, beta polypeptide
NCBI Official Symbol
C8b
NCBI Official Synonym Symbols
AI595927; 4930439B20Rik
NCBI Protein Information
complement component C8 beta chain
UniProt Protein Name
Complement component C8 beta chain
Protein Family
UniProt Gene Name
C8b
NCBI Description
This gene encodes the beta subunit of complement component C8 that participates in the assembly of the complement membrane attack complex. The encoded preproprotein undergoes proteolytic processing to generate the beta subunit, which associates with the alpha and gamma subunits to form a trimeric complement component, C8. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. This gene is located adjacent to the gene encoding the alpha subunit. [provided by RefSeq, Oct 2015]
Uniprot Description
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells.
Similar Products
Product Notes
The C8b c8b (Catalog #AAA1285204) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 54-589, Full length protein. The amino acid sequence is listed below: SVAEAPAPID CELSTWSSWT ACDPCQKKRY RHTYLLRPSQ FYGELCDLSD KEVEDCVTNQ PCRSQVRCEG FVCAQTGRCV NRRLLCNGDN DCGDQSDEAN CRRIYKNCQR EMEQYWAIDR LASGINLFTN TFEGPVLDHR YYAGGCSPHY ILDTNFRKPY NVESYTPQTK CEYEFTLTEY ESYSDFERLV IEKKTHMFNF TSGFKVDGVM DLGIKVESNE GKNYVTRTKR FAHTQSKFLH ARSVLEVAHY KLKSRSLMLH YEFLQRVKSL PLEYSYGEYR DLLRDFGTHF ITEAVLGGIY EYTLIMNKDA MEQGDYTLSH VTACAGGSFG IGGMVYKVYV KVGVSAKKCS DIMKEINERN KRSTMVEDLV VLVRGGTSED ITALAYKELP TPELMEAWGD AVKYNPAIIK IKAEPLYELV TATDFAYSST VKQNLKKALE EFQSEVSSCR CAPCRGNGVP VLKGSRCECI CPGGFQGTAC EVTYRKDIPI DGKWSCWSDW SACSGGHKTR HRQCNNPAPH KGGSPCSGPA SETLNC. It is sometimes possible for the material contained within the vial of "Complement component C8 beta chain (C8b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
