Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

V-type proton ATPase subunit C 1 (Atp6v1c1) Recombinant Protein | Atp6v1c1 recombinant protein

Recombinant Rat V-type proton ATPase subunit C 1 (Atp6v1c1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
V-type proton ATPase subunit C 1 (Atp6v1c1); Recombinant Rat V-type proton ATPase subunit C 1 (Atp6v1c1); Atp6v1c1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-382, full length protein
Sequence
TEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFKKAVDDFRHKARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
Sequence Length
381
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Atp6v1c1 recombinant protein
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c , c , and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,901 Da
NCBI Official Full Name
V-type proton ATPase subunit C 1
NCBI Official Synonym Full Names
ATPase H+ transporting V1 subunit C1
NCBI Official Symbol
Atp6v1c1
NCBI Protein Information
V-type proton ATPase subunit C 1
UniProt Protein Name
V-type proton ATPase subunit C 1
Protein Family
UniProt Gene Name
Atp6v1c1
UniProt Synonym Gene Names
V-ATPase subunit C 1

Uniprot Description

Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells ().

Similar Products

Product Notes

The Atp6v1c1 atp6v1c1 (Catalog #AAA1394253) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-382, full length protein. The amino acid sequence is listed below: TEFWLISAPG EKTCQQTWEK LHAATTKNNN LAVSSKFNIP DLKVGTLDVL VGLSDELAKL DAFVEGVVKK VAQYMADVLE DSKDKVQENL LASGVDLVTY ITRFQWDMAK YPIKQSLKNI SEIIAKGVTQ IDNDLKSRAS AYNNLKGNLQ NLERKNAGSL LTRSLAEIVK KDDFVLDSEY LVTLLVVVPK LNHNDWIKQY ETLAEMVVPR SSNVLSEDQD SYLCNVTLFK KAVDDFRHKA RENKFIVRDF QYNEEEMRAD KEEMNRLSTD KKKQFGPLVR WLKVNFSEAF IAWIHIKALR VFVESVLRYG LPVNFQAMLL QPNKKSVKKL REVLHELYKH LDSSAAAIID APMDIPGLNL SQQEYYPYVY YKIDCNLLEF K. It is sometimes possible for the material contained within the vial of "V-type proton ATPase subunit C 1 (Atp6v1c1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.