Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c) Recombinant Protein | Atp6v0c recombinant protein

Recombinant Mouse V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c)

Gene Names
Atp6v0c; Atpl; PL16; VATL; Vma3; Atp6c; Atp6l; Atp6c2; Atpl-rs1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c); Recombinant Mouse V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c); Recombinant V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c); V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; PL16 Vacuolar proton pump 16 kDa proteolipid subunit; Atp6v0c recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-155
Sequence
MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sequence Length
155
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,808 Da
NCBI Official Full Name
V-type proton ATPase 16 kDa proteolipid subunit
NCBI Official Synonym Full Names
ATPase, H+ transporting, lysosomal V0 subunit C
NCBI Official Symbol
Atp6v0c
NCBI Official Synonym Symbols
Atpl; PL16; VATL; Vma3; Atp6c; Atp6l; Atp6c2; Atpl-rs1
NCBI Protein Information
V-type proton ATPase 16 kDa proteolipid subunit; H(+)-ATPase (mvp); V-ATPase 16 kDa proteolipid subunit; ATPase, H+ transporting, lysosomal 2; vacuolar proton pump 16 kDa proteolipid subunit; ATPase, H+ transporting, lysosomal 16kD, V0 subunit C; ATPase, H+ transporting, lysosomal (vacuolar proton pump) 16 kDa
UniProt Protein Name
V-type proton ATPase 16 kDa proteolipid subunit
UniProt Gene Name
Atp6v0c
UniProt Synonym Gene Names
Atp6c; Atp6l; Atpl; Mvp; V-ATPase 16 kDa proteolipid subunit
UniProt Entry Name
VATL_MOUSE

Uniprot Description

Function: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Subunit structure: V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (main components: subunits A, B, C, D, E, and F) attached to an integral membrane V0 proton pore complex (main component: the proteolipid protein; which is present as a hexamer that forms the proton-conducting pore). Interacts with RNF182; this interaction leads to ubiquitination and degradation via the proteasome pathway

By similarity.

Subcellular location: Vacuole membrane; Multi-pass membrane protein.

Post-translational modification: Ubiquitinated by RNF182, leading to its degradation via the ubiquitin-proteasome pathway

By similarity.

Sequence similarities: Belongs to the V-ATPase proteolipid subunit family.

Research Articles on Atp6v0c

Similar Products

Product Notes

The Atp6v0c atp6v0c (Catalog #AAA717866) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-155. The amino acid sequence is listed below: MADIKNNPEY SSFFGVMGAS SAMVFSAMGA AYGTAKSGTG IAAMSVMRPE LIMKSIIPVV MAGIIAIYGL VVAVLIANSL TDGITLYRSF LQLGAGLSVG LSGLAAGFAI GIVGDAGVRG TAQQPRLFVG MILILIFAEV LGLYGLIVAL ILSTK. It is sometimes possible for the material contained within the vial of "V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.