Adenylate cyclase type 1 (ADCY1) Recombinant Protein | ADCY1 recombinant protein
Recombinant Bovine Adenylate cyclase type 1 (ADCY1), partial
Gene Names
ADCY1; AC1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenylate cyclase type 1 (ADCY1); Recombinant Bovine Adenylate cyclase type 1 (ADCY1); partial; ADCY1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
798-1134. Partial-length, covers the Guanylate cyclase 2 Domain
Sequence
SCTLALHARQVDVKLRLDYLWAAQAEEERDDMEKVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTKAKKCISSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRGSYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQTRSLNSERKMYPFGRAGLQTRLAAGHPPVPPAAGLPVGAGPGALQGSGLAPGPPGQHLPPGASGKEA
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123,979 Da
NCBI Official Full Name
adenylate cyclase type 1
NCBI Official Synonym Full Names
adenylate cyclase 1
NCBI Official Symbol
ADCY1
NCBI Official Synonym Symbols
AC1
NCBI Protein Information
adenylate cyclase type 1
UniProt Protein Name
Adenylate cyclase type 1
Protein Family
UniProt Gene Name
ADCY1
UniProt Synonym Gene Names
AC1
Uniprot Description
Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling (PubMed:2472670, PubMed:2022671. PubMed:19029295). Mediates responses to increased cellular Ca2+/calmodulin levels (PubMed:2022671, PubMed:19029295). May be involved in regulatory processes in the central nervous system. May play a role in memory and learning. Plays a role in the regulation of the circadian rhythm of daytime contrast sensitivity probably by modulating the rhythmic synthesis of cyclic AMP in the retina ().
Similar Products
Product Notes
The ADCY1 adcy1 (Catalog #AAA954327) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 798-1134. Partial-length, covers the Guanylate cyclase 2 Domain. The amino acid sequence is listed below: SCTLALHARQ VDVKLRLDYL WAAQAEEERD DMEKVKLDNK RILFNLLPAH VAQHFLMSNP RNMDLYYQSY SQVGVMFASI PNFNDFYIEL DGNNMGVECL RLLNEIIADF DELMDKDFYK DLEKIKTIGS TYMAAVGLAP TAGTKAKKCI SSHLSTLADF AIEMFDVLDE INYQSYNDFV LRVGINVGPV VAGVIGARRP QYDIWGNTVN VASRMDSTGV QGRIQVTEEV HRLLRRGSYR FVCRGKVSVK GKGEMLTYFL EGRTDGNGSQ TRSLNSERKM YPFGRAGLQT RLAAGHPPVP PAAGLPVGAG PGALQGSGLA PGPPGQHLPP GASGKEA . It is sometimes possible for the material contained within the vial of "Adenylate cyclase type 1 (ADCY1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
