Low-density lipoprotein receptor-related protein 1 (LRP1) Recombinant Protein | LRP1 recombinant protein
Recombinant Chicken Low-density lipoprotein receptor-related protein 1 (LRP1), partial
Gene Names
LRP1; A2MR; LRP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Low-density lipoprotein receptor-related protein 1 (LRP1); Recombinant Chicken Low-density lipoprotein receptor-related protein 1 (LRP1); partial; LRP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-336aa, Fragment at the N-terminal
Sequence
KTCSPKQFACKDQITCISKGWRCDGEKDCPDGSDESPDICPQSKVSRCQPNEHNCL GTELCIHMSKLCNGLHDCFDGSDEGPHCREQLANCTALGCQHHCVPTLSGPACYCN NSFQLAEDRRSCKDFDECTVYGTCSQTCTNTEGSYTCSCVEGYLLQPDNRSCKAKN EPVDRPPVLLIANSQNILATYLSGAPVPNITPTSAKQTTAMDFNYIEDTVCWVHVGDS ASQTILKCAKIPNLKGFVEERSINISLSLHQVEQMAIDWLTGNFYFVDDIDDRIFVCNKN GLTCVTLLDLELYNPKGIALDPAM
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
506,631 Da
NCBI Official Full Name
low-density lipoprotein receptor-related protein 1
NCBI Official Synonym Full Names
LDL receptor related protein 1
NCBI Official Symbol
LRP1
NCBI Official Synonym Symbols
A2MR; LRP-1
NCBI Protein Information
low-density lipoprotein receptor-related protein 1
UniProt Protein Name
Low-density lipoprotein receptor-related protein 1
Protein Family
UniProt Gene Name
LRP1
UniProt Synonym Gene Names
LRP-1; A2MR
Uniprot Description
Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. Acts as an alpha-2-macroglobulin receptor.
Research Articles on LRP1
Similar Products
Product Notes
The LRP1 lrp1 (Catalog #AAA957575) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-336aa, Fragment at the N-terminal. The amino acid sequence is listed below: KTCSPKQFAC KDQITCISKG WRCDGEKDCP DGSDESPDIC PQSKVSRCQP NEHNCL GTELCIHMSK LCNGLHDCFD GSDEGPHCRE QLANCTALGC QHHCVPTLSG PACYCN NSFQLAEDRR SCKDFDECTV YGTCSQTCTN TEGSYTCSCV EGYLLQPDNR SCKAKN EPVDRPPVLL IANSQNILAT YLSGAPVPNI TPTSAKQTTA MDFNYIEDTV CWVHVGDS ASQTILKCAK IPNLKGFVEE RSINISLSLH QVEQMAIDWL TGNFYFVDDI DDRIFVCNKN GLTCVTLLDL ELYNPKGIAL DPAM. It is sometimes possible for the material contained within the vial of "Low-density lipoprotein receptor-related protein 1 (LRP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
