DNA repair protein RAD52 homolog (RAD52) Recombinant Protein | RAD52 recombinant protein
Recombinant Chicken DNA repair protein RAD52 homolog (RAD52)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA repair protein RAD52 homolog (RAD52); Recombinant Chicken DNA repair protein RAD52 homolog (RAD52); RAD52 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-422, Full length protein
Sequence
MPERQGKDSESHVSSSCTSTSNSVACFGQYQYTANEYQAIQHALRQKLGPEYISSRQAGGGQKVCYIEGHKVISLANEMFGFNGWAHSVTQQNVDFVDLNNGRFYVGVCAFVKVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALKCFGNALGNCILDKDYLQAVNKLPRQMPPELDLVKTKRQDYEPEIEKARYDGCLERQNPGWRQQCEMAPTCKPTHTEASRVTEDQKQPSSSGNTDSPAVECDATYQRKLRQKQLQQQFWEQMEKRRQVKEVTPSSKQATANPPVKHSTPAAVQQELAIEEEFFADDLELWDISLETTDLNKLMCHKAAGSPAAQQPPETPHRRHQMTTRNRTPQRMHYHKPPVRFAQLQPSAALTSNSHGANQRTPAEHSPYRRSQSWKKRRLEPT
Sequence Length
422
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RAD52 recombinant protein
This protein shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
47,722 Da
NCBI Official Full Name
DNA repair protein RAD52 homolog
NCBI Official Synonym Full Names
RAD52 homolog, DNA repair protein
NCBI Official Symbol
RAD52
NCBI Protein Information
DNA repair protein RAD52 homolog
UniProt Protein Name
DNA repair protein RAD52 homolog
Protein Family
UniProt Gene Name
RAD52
Uniprot Description
Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase ().
Research Articles on RAD52
Similar Products
Product Notes
The RAD52 rad52 (Catalog #AAA955843) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-422, Full length protein. The amino acid sequence is listed below: MPERQGKDSE SHVSSSCTST SNSVACFGQY QYTANEYQAI QHALRQKLGP EYISSRQAGG GQKVCYIEGH KVISLANEMF GFNGWAHSVT QQNVDFVDLN NGRFYVGVCA FVKVQLKDGS YHEDVGYGVS EGLKSKALSL EKARKEAVTD GLKRALKCFG NALGNCILDK DYLQAVNKLP RQMPPELDLV KTKRQDYEPE IEKARYDGCL ERQNPGWRQQ CEMAPTCKPT HTEASRVTED QKQPSSSGNT DSPAVECDAT YQRKLRQKQL QQQFWEQMEK RRQVKEVTPS SKQATANPPV KHSTPAAVQQ ELAIEEEFFA DDLELWDISL ETTDLNKLMC HKAAGSPAAQ QPPETPHRRH QMTTRNRTPQ RMHYHKPPVR FAQLQPSAAL TSNSHGANQR TPAEHSPYRR SQSWKKRRLE PT. It is sometimes possible for the material contained within the vial of "DNA repair protein RAD52 homolog (RAD52), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
