Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

V-type proton ATPase subunit E 1 (Atp6v1e1) Recombinant Protein | Atp6v1e1 recombinant protein

Recombinant Mouse V-type proton ATPase subunit E 1 (Atp6v1e1)

Gene Names
Atp6v1e1; p31; Vma4; Atp6e; Atp6e2; Atp6v1e; D6Ertd385e; 2410029D23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
V-type proton ATPase subunit E 1 (Atp6v1e1); Recombinant Mouse V-type proton ATPase subunit E 1 (Atp6v1e1); Atp6v1e1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-226, Full length protein
Sequence
ALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Sequence Length
225
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Atp6v1e1 recombinant protein
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,157 Da
NCBI Official Full Name
V-type proton ATPase subunit E 1
NCBI Official Synonym Full Names
ATPase, H+ transporting, lysosomal V1 subunit E1
NCBI Official Symbol
Atp6v1e1
NCBI Official Synonym Symbols
p31; Vma4; Atp6e; Atp6e2; Atp6v1e; D6Ertd385e; 2410029D23Rik
NCBI Protein Information
V-type proton ATPase subunit E 1
UniProt Protein Name
V-type proton ATPase subunit E 1
UniProt Gene Name
Atp6v1e1
UniProt Synonym Gene Names
Atp6e; Atp6e2; V-ATPase subunit E 1; p31

Uniprot Description

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Research Articles on Atp6v1e1

Similar Products

Product Notes

The Atp6v1e1 atp6v1e1 (Catalog #AAA954702) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-226, Full length protein. The amino acid sequence is listed below: ALSDADVQKQ IKHMMAFIEQ EANEKAEEID AKAEEEFNIE KGRLVQTQRL KIMEYYEKKE KQIEQQKKIQ MSNLMNQARL KVLRARDDLI TDLLNEAKQR LSKVVKDTTR YQVLLDGLVL QGLYQLLEPR MIVRCRKQDF PLVKAAVQKA IPMYKIATKK DVDVQIDQEA YLPEEIAGGV EIYNGDRKIK VSNTLESRLD LIAQQMMPEV RGALFGANAN RKFLD. It is sometimes possible for the material contained within the vial of "V-type proton ATPase subunit E 1 (Atp6v1e1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.