Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Mouse RAB39B Polyclonal Antibody | anti-RAB39B antibody

RAB39B Rabbit pAb

Gene Names
RAB39B; WSMN; MRX72
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
RAB39B; Polyclonal Antibody; RAB39B Rabbit pAb; MRX72; WSMN; anti-RAB39B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC
Applicable Applications for anti-RAB39B antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-213 of human RAB39B (NP_741995.1).
Cellular Location
Cell membrane, Cytoplasmic side, Golgi apparatus, Lipid-anchor
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-RAB39B antibody
Background: This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked mental retardation.
Product Categories/Family for anti-RAB39B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,622 Da
NCBI Official Full Name
ras-related protein Rab-39B
NCBI Official Synonym Full Names
RAB39B, member RAS oncogene family
NCBI Official Symbol
RAB39B
NCBI Official Synonym Symbols
WSMN; MRX72
NCBI Protein Information
ras-related protein Rab-39B
UniProt Protein Name
Ras-related protein Rab-39B
Protein Family
UniProt Gene Name
RAB39B
UniProt Entry Name
RB39B_HUMAN

Uniprot Description

RAB39B: May be involved in vesicular trafficking. Plays a role in synapse formation. Defects in RAB39B are the cause of mental retardation X- linked type 72 (MRX72). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRX72 patients can manifest autism spectrum disorder, seizures and macrocephaly as additional features. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: Golgi apparatus; intracellular; neuron projection; vesicle

Molecular Function: myosin V binding; protein binding

Biological Process: synapse organization and biogenesis; vesicle-mediated transport

Disease: Mental Retardation, X-linked 72

Similar Products

Product Notes

The RAB39B rab39b (Catalog #AAA9142372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB39B Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RAB39B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RAB39B rab39b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEAIWLYQFR LIVIGDSTVG KSCLIRRFTE GRFAQVSDPT VGVDFFSRLV EIEPGKRIKL QIWDTAGQER FRSITRAYYR NSVGGLLLFD ITNRRSFQNV HEWLEETKVH VQPYQIVFVL VGHKCDLDTQ RQVTRHEAEK LAAAYGMKYI ETSARDAINV EKAFTDLTRD IYELVKRGEI TIQEGWEGVK SGFVPNVVHS SEEVVKSERR CLC. It is sometimes possible for the material contained within the vial of "RAB39B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.