Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gap junction alpha-8 protein (GJA8) Recombinant Protein | GJA8 recombinant protein

Recombinant Chicken Gap junction alpha-8 protein (GJA8)

Gene Names
GJA8; Cx50; Cx45.6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gap junction alpha-8 protein (GJA8); Recombinant Chicken Gap junction alpha-8 protein (GJA8); Recombinant Gap junction alpha-8 protein (GJA8); Gap junction alpha-8 protein; Connexin-45.6; Cx45.6; GJA8 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-400
Sequence
GDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPGCENVCYDEAFPISHIRLWVLQIIFVSTPSLVYFGHAVHHVRMEEKRKEREEAERRQQAEVDEEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYILHIIFKTLFEVGFIVGQYFLYGFRILPLYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVAAVSLFLNLVEISHLILKRIRRALRRPAEEQMGEVPEKPLHAIAVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEFEEKIGMGPLEDLSRAFDERLPSYAQAKEPEEEKVKAEEEEEQEEEQQAPQEEPGVKKAEEEVVSDEVEGPSAPAELATDVRSLSRLSKASSRARSDDLTV
Sequence Length
400
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,616 Da
NCBI Official Full Name
gap junction alpha-8 protein
NCBI Official Synonym Full Names
gap junction protein, alpha 8, 50kDa
NCBI Official Symbol
GJA8
NCBI Official Synonym Symbols
Cx50; Cx45.6
NCBI Protein Information
gap junction alpha-8 protein; connexin 50; connexin 45.6; connexin-45.6
UniProt Protein Name
Gap junction alpha-8 protein
UniProt Gene Name
GJA8
UniProt Synonym Gene Names
Cx45.6
UniProt Entry Name
CXA8_CHICK

Uniprot Description

Function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Subunit structure: A connexon is composed of a hexamer of connexins. During early stages of lens development, interacts with the C-terminus of MIP. Ref.5

Subcellular location: Cell membrane; Multi-pass membrane protein. Cell junction › gap junction.

Post-translational modification: Proteolytically cleaved by caspase-3 during lens development. Ref.4Phosphorylated on Ser-364; which inhibits cleavage by caspase-3. Ref.3 Ref.4

Sequence similarities: Belongs to the connexin family. Alpha-type (group II) subfamily.

Research Articles on GJA8

Similar Products

Product Notes

The GJA8 gja8 (Catalog #AAA718802) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-400. The amino acid sequence is listed below: GDWSFLGNIL EQVNEQSTVI GRVWLTVLFI FRILILGTAA ELVWGDEQSD FVCNTQQPGC ENVCYDEAFP ISHIRLWVLQ IIFVSTPSLV YFGHAVHHVR MEEKRKEREE AERRQQAEVD EEKLPLAPNQ NKGNNPDGTK KFRLEGTLLR TYILHIIFKT LFEVGFIVGQ YFLYGFRILP LYRCGRWPCP NLVDCFVSRP TEKTIFIMFM LVVAAVSLFL NLVEISHLIL KRIRRALRRP AEEQMGEVPE KPLHAIAVSS IPKAKGYKLL EEEKPVSHYF PLTEVGVEPS PLPSAFNEFE EKIGMGPLED LSRAFDERLP SYAQAKEPEE EKVKAEEEEE QEEEQQAPQE EPGVKKAEEE VVSDEVEGPS APAELATDVR SLSRLSKASS RARSDDLTV. It is sometimes possible for the material contained within the vial of "Gap junction alpha-8 protein (GJA8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.