Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interferon gamma receptor 1 Recombinant Protein | Ifngr1 recombinant protein

Interferon gamma receptor 1

Gene Names
Ifngr1; Ifgr; CD119; Ifngr; Nktar; IFN-gammaR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon gamma receptor 1; Ifngr1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-477aa; full length protein
Sequence
GSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDSIWILVVAPLTVFTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKSATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEELSKETKALEAGGSTSAMTPDSPPTPTQRRSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLPNNNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Ifngr1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Ifngr1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,343 Da
NCBI Official Full Name
interferon gamma receptor 1
NCBI Official Synonym Full Names
interferon gamma receptor 1
NCBI Official Symbol
Ifngr1
NCBI Official Synonym Symbols
Ifgr; CD119; Ifngr; Nktar; IFN-gammaR
NCBI Protein Information
interferon gamma receptor 1
UniProt Protein Name
Interferon gamma receptor 1
Protein Family
UniProt Gene Name
Ifngr1
UniProt Synonym Gene Names
Ifngr; IFN-gamma receptor 1; IFN-gamma-R1
UniProt Entry Name
INGR1_MOUSE

Uniprot Description

IFNGR1: Receptor for interferon gamma. Two receptors bind one interferon gamma dimer. Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD); also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. Belongs to the type II cytokine receptor family.

Protein type: Receptor, cytokine; Membrane protein, integral

Cellular Component: dendrite; endoplasmic reticulum; integral to membrane; plasma membrane; postsynaptic density; vesicle

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interleukin-20 binding

Biological Process: cytokine and chemokine mediated signaling pathway

Research Articles on Ifngr1

Similar Products

Product Notes

The Ifngr1 ifngr1 (Catalog #AAA7042886) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-477aa; full length protein. The amino acid sequence is listed below: GSGALTSTED PEPPSVPVPT NVLIKSYNLN PVVCWEYQNM SQTPIFTVQV KVYSGSWTDS CTNISDHCCN IYEQIMYPDV SAWARVKAKV GQKESDYARS KEFLMCLKGK VGPPGLEIRR KKEEQLSVLV FHPEVVVNGE SQGTMFGDGS TCYTFDYTVY VEHNRSGEIL HTKHTVEKEE CNETLCELNI SVSTLDSRYC ISVDGISSFW QVRTEKSKDV CIPPFHDDRK DSIWILVVAP LTVFTVVILV FAYWYTKKNS FKRKSIMLPK SLLSVVKSAT LETKPESKYS LVTPHQPAVL ESETVICEEP LSTVTAPDSP EAAEQEELSK ETKALEAGGS TSAMTPDSPP TPTQRRSFSL LSSNQSGPCS LTAYHSRNGS DSGLVGSGSS ISDLESLPNN NSETKMAEHD PPPVRKAPMA SGYDKPHMLV DVLVDVGGKE SLMGYRLTGE AQELS. It is sometimes possible for the material contained within the vial of "Interferon gamma receptor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.