Potassium voltage-gated channel subfamily A member 7 (Kcna7) Recombinant Protein | Kcna7 recombinant protein
Recombinant Mouse Potassium voltage-gated channel subfamily A member 7 (Kcna7)
Gene Names
Kcna7; Kv1.7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily A member 7 (Kcna7); Recombinant Mouse Potassium voltage-gated channel subfamily A member 7 (Kcna7); Kcna7 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-489aa; full length protein
Sequence
MLFLPADTGHPTGVAAASGPHVRSPVARAVRAMEPRCPPPCGCCERLVLNVAGLRFETRA RTLGRFPDTLLGDPVRRSRFYDGARREYFFDRHRPSFDAVLYYYQSGGRLRRPAHVPLDV FLEEVSFYGLGAAALARLREDEGCAVPPERPLPRRAFARQLWLLFEFPESSQAARVLAVV SVLVILVSIVVFCLETLPDFRDDRDDPGLAPVAAATGPFLARLNGSSPMPGAPPRQPFND PFFVVETLCICWFSFELLVRLVACPSKAVFFKNVMNLIDFVAILPYFVALGTELARQRGV GQPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFS SAVYFAEVDRVDTHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTIS LPVPVIVSNFSYFYHRETEGEEAGMYSHVDTQPCGTLEGKANGGLVDSEVPELLPPLWPP AGKHMVTEV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Kcna7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,755 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 7
NCBI Official Synonym Full Names
potassium voltage-gated channel, shaker-related subfamily, member 7
NCBI Official Symbol
Kcna7
NCBI Official Synonym Symbols
Kv1.7
NCBI Protein Information
potassium voltage-gated channel subfamily A member 7
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 7
Protein Family
UniProt Gene Name
Kcna7
UniProt Synonym Gene Names
Kcnc7
UniProt Entry Name
KCNA7_MOUSE
Uniprot Description
Kv1.7: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.7/KCNA7 sub-subfamily.
Protein type: Membrane protein, multi-pass
Cellular Component: integral to membrane; membrane; voltage-gated potassium channel complex
Molecular Function: delayed rectifier potassium channel activity; ion channel activity; potassium channel activity; voltage-gated ion channel activity; voltage-gated potassium channel activity
Biological Process: ion transport; potassium ion transport; protein homooligomerization; transmembrane transport; transport
Research Articles on Kcna7
Similar Products
Product Notes
The Kcna7 kcna7 (Catalog #AAA7017626) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-489aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Kcna7 kcna7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLFLPADTGH PTGVAAASGP HVRSPVARAV RAMEPRCPPP CGCCERLVLN VAGLRFETRA RTLGRFPDTL LGDPVRRSRF YDGARREYFF DRHRPSFDAV LYYYQSGGRL RRPAHVPLDV FLEEVSFYGL GAAALARLRE DEGCAVPPER PLPRRAFARQ LWLLFEFPES SQAARVLAVV SVLVILVSIV VFCLETLPDF RDDRDDPGLA PVAAATGPFL ARLNGSSPMP GAPPRQPFND PFFVVETLCI CWFSFELLVR LVACPSKAVF FKNVMNLIDF VAILPYFVAL GTELARQRGV GQPAMSLAIL RVIRLVRVFR IFKLSRHSKG LQILGQTLRA SMRELGLLIF FLFIGVVLFS SAVYFAEVDR VDTHFTSIPE SFWWAVVTMT TVGYGDMAPV TVGGKIVGSL CAIAGVLTIS LPVPVIVSNF SYFYHRETEG EEAGMYSHVD TQPCGTLEGK ANGGLVDSEV PELLPPLWPP AGKHMVTEV. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily A member 7 (Kcna7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
