Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Potassium voltage-gated channel subfamily A member 2 (kcna2) Recombinant Protein | kcna2 recombinant protein

Recombinant Oncorhynchus mykiss Potassium voltage-gated channel subfamily A member 2 (kcna2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily A member 2 (kcna2); Recombinant Oncorhynchus mykiss Potassium voltage-gated channel subfamily A member 2 (kcna2); kcna2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-494aa; full length protein
Sequence
MTVATGDPSDEAAAHPGNPAEYDPDADHECCERVVINISGLRFETQLKTLSQFPDTLLGD PKKRMRYFDPLRNEYFFDRSRTSFDAILYFYQSGGRLRRPANVTLDIFSEEIRFYELGDE AIELFREDEGFVKEEERPLPDNEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFC LETLPIFRNDDDEPHSVFDTNTNTTIYFTSTYFTDPFFILETLCIIWFSFEFLVRLFACP SKSGFFGNVMNIIDVVAIIPYFITLATELAEKPEDGQAGQQAMSLAILRVIRLVRVFRIF KLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFESIPDAF WWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEE QAQCLGPVTKEDSNEELKKSRSGSTISKSDYMEIQEGVNNTIEDIPEENLKTQANCTTLA NTNYVNITKMLTDV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for kcna2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
55,900 Da
NCBI Official Full Name
Potassium voltage-gated channel subfamily A member 2
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 2
UniProt Gene Name
kcna2
UniProt Entry Name
KCNA2_ONCMY

Uniprot Description

Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and central nervous system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane (). Can form functional homotetrameric channels and heterotetrameric channels with other family members; the channels characteristics depend critically on the types of channel-forming alpha subunits that are present (). Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits (). In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure (). Regulates neuronal excitability and plays a role as pacemaker in the regulation of neuronal action potentials (). KCNA2-containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing (). Response to toxins that are selective for KCNA2-containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2-containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination (). Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus ().

Similar Products

Product Notes

The kcna2 kcna2 (Catalog #AAA7017606) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-494aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the kcna2 kcna2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTVATGDPSD EAAAHPGNPA EYDPDADHEC CERVVINISG LRFETQLKTL SQFPDTLLGD PKKRMRYFDP LRNEYFFDRS RTSFDAILYF YQSGGRLRRP ANVTLDIFSE EIRFYELGDE AIELFREDEG FVKEEERPLP DNEFQRQVWL LFEYPESSGP ARIIAIISVM VILISIVSFC LETLPIFRND DDEPHSVFDT NTNTTIYFTS TYFTDPFFIL ETLCIIWFSF EFLVRLFACP SKSGFFGNVM NIIDVVAIIP YFITLATELA EKPEDGQAGQ QAMSLAILRV IRLVRVFRIF KLSRHSKGLQ ILGQTLKASM RELGLLIFFL FIGVILFSSA VYFAEADEPE SQFESIPDAF WWAVVSMTTV GYGDMVPTTI GGKIVGSLCA IAGVLTIALP VPVIVSNFNY FYHRETEGEE QAQCLGPVTK EDSNEELKKS RSGSTISKSD YMEIQEGVNN TIEDIPEENL KTQANCTTLA NTNYVNITKM LTDV. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily A member 2 (kcna2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.