Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interferon-induced transmembrane protein 1 (Ifitm1) Recombinant Protein | Ifitm1 recombinant protein

Recombinant Mouse Interferon-induced transmembrane protein 1 (Ifitm1)

Gene Names
Ifitm1; Mil2; Mil-2; DSPA2a; 1110036C17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon-induced transmembrane protein 1 (Ifitm1); Recombinant Mouse Interferon-induced transmembrane protein 1 (Ifitm1); Ifitm1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-106aa; full length protein
Sequence
MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSV KSRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ifitm1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,524 Da
NCBI Official Full Name
interferon-induced transmembrane protein 1
NCBI Official Synonym Full Names
interferon induced transmembrane protein 1
NCBI Official Symbol
Ifitm1
NCBI Official Synonym Symbols
Mil2; Mil-2; DSPA2a; 1110036C17Rik
NCBI Protein Information
interferon-induced transmembrane protein 1
UniProt Protein Name
Interferon-induced transmembrane protein 1
UniProt Gene Name
Ifitm1
UniProt Synonym Gene Names
DSPA2a; Mil-2
UniProt Entry Name
IFM1_MOUSE

Uniprot Description

IFITM1: IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV) and West Nile virus (WNV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation

Protein type: Membrane protein, integral; Cell cycle regulation; Membrane protein, multi-pass

Cellular Component: integral to membrane; membrane; plasma membrane

Biological Process: anterior/posterior pattern formation; defense response to virus; immune system process; innate immune response; negative regulation of virion penetration into host cell; ossification; response to biotic stimulus; response to virus; somitogenesis

Research Articles on Ifitm1

Similar Products

Product Notes

The Ifitm1 ifitm1 (Catalog #AAA7017421) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-106aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ifitm1 ifitm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPKEQQEVVV LGSPHISTSA TATTINMPEI STPDHVVWSL FNTLFMNFCC LGFVAYAYSV KSRDRKMVGD TTGAQAFAST AKCLNISSLF FTILTAIVVI VVCAIR. It is sometimes possible for the material contained within the vial of "Interferon-induced transmembrane protein 1 (Ifitm1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.