Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human Serum Amyloid A1 Polyclonal Antibody | anti-SAA1 antibody

Serum Amyloid A1 (SAA1, Amyloid Fibril Protein AA, Amyloid Protein A, MGC111216, PIG4, SAA2, Serum Amyloid A Protein Precursor, SAA, Tumor Protein p53 Inducible Protein 4, TP53I4) (MaxLight 550)

Gene Names
SAA1; SAA; PIG4; SAA2; TP53I4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Serum Amyloid A1; Polyclonal Antibody; Serum Amyloid A1 (SAA1; Amyloid Fibril Protein AA; Amyloid Protein A; MGC111216; PIG4; SAA2; Serum Amyloid A Protein Precursor; SAA; Tumor Protein p53 Inducible Protein 4; TP53I4) (MaxLight 550); anti-SAA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SAA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SAA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SAA1, aa1-122 (NP_000322.2).
Immunogen Sequence
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SAA1 antibody
Human Serum Amyloid A protein-1 (SAA-1) is a multifunctional apolipoprotein produced by hepatocytes in response to proinflammatory cytokines. It is secreted as a 12kD, 104aa, nonglycosylated polypeptide that displaces apoA1 in the HDL 3 complex. The SAA-1 gene is one of three SAA genes in human, and it shows multiple alleles that are race dependent. The SAA-1 gene product differs from the SAA-2 gene product by only seven amino acids. Circulating SAA-1 shows multiple proteolytically-generated isoforms, with anywhere from one-to-three amino acids being cleaved from either the N-or C-terminus.
Product Categories/Family for anti-SAA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,532 Da
NCBI Official Full Name
serum amyloid A-1 protein preproprotein
NCBI Official Synonym Full Names
serum amyloid A1
NCBI Official Symbol
SAA1
NCBI Official Synonym Symbols
SAA; PIG4; SAA2; TP53I4
NCBI Protein Information
serum amyloid A-1 protein; serum amyloid A protein; tumor protein p53 inducible protein 4
UniProt Protein Name
Serum amyloid A-1 protein
Protein Family
UniProt Gene Name
SAA1
UniProt Synonym Gene Names
SAA
UniProt Entry Name
SAA1_HUMAN

NCBI Description

This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.[provided by RefSeq, Jun 2012]

Uniprot Description

SAA1: Major acute phase reactant. Apolipoprotein of the HDL complex. Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA1 protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Elevated serum SAA1 protein levels may be associated with lung cancer. Belongs to the SAA family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: extracellular region

Molecular Function: heparin binding; G-protein-coupled receptor binding

Biological Process: positive regulation of interleukin-1 secretion; receptor-mediated endocytosis; platelet activation; neutrophil chemotaxis; elevation of cytosolic calcium ion concentration; positive regulation of cell adhesion; regulation of protein secretion; negative regulation of inflammatory response; acute-phase response; innate immune response; lymphocyte chemotaxis; macrophage chemotaxis; positive regulation of cytokine secretion

Research Articles on SAA1

Similar Products

Product Notes

The SAA1 saa1 (Catalog #AAA6393856) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Serum Amyloid A1 (SAA1, Amyloid Fibril Protein AA, Amyloid Protein A, MGC111216, PIG4, SAA2, Serum Amyloid A Protein Precursor, SAA, Tumor Protein p53 Inducible Protein 4, TP53I4) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Serum Amyloid A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SAA1 saa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Serum Amyloid A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.