Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RFC1 Monoclonal Antibody | anti-RFC1 antibody

RFC1 (RFC140, Replication Factor C Subunit 1, Activator 1 140kD Subunit, Activator 1 Large Subunit, Activator 1 Subunit 1, DNA-binding Protein PO-GA, Replication Factor C 140kD Subunit, Replication Factor C Large Subunit, MGC51786) (MaxLight 750)

Gene Names
RFC1; A1; RFC; PO-GA; RECC1; CANVAS; MHCBFB; RFC140
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RFC1; Monoclonal Antibody; RFC1 (RFC140; Replication Factor C Subunit 1; Activator 1 140kD Subunit; Activator 1 Large Subunit; Activator 1 Subunit 1; DNA-binding Protein PO-GA; Replication Factor C 140kD Subunit; Replication Factor C Large Subunit; MGC51786) (MaxLight 750); anti-RFC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
3F8
Specificity
Recognizes human RFC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
4867
Applicable Applications for anti-RFC1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110, from human RFC1 (AAH51786) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RFC1 antibody
The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq].
Product Categories/Family for anti-RFC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens replication factor C (activator 1) 1, 145kDa, mRNA
NCBI Official Synonym Full Names
replication factor C subunit 1
NCBI Official Symbol
RFC1
NCBI Official Synonym Symbols
A1; RFC; PO-GA; RECC1; CANVAS; MHCBFB; RFC140
NCBI Protein Information
replication factor C subunit 1
Protein Family

NCBI Description

This gene encodes the large subunit of replication factor C, a five subunit DNA polymerase accessory protein, which is a DNA-dependent ATPase required for eukaryotic DNA replication and repair. The large subunit acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It may also have a role in telomere stability. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Mar 2011]

Research Articles on RFC1

Similar Products

Product Notes

The RFC1 (Catalog #AAA6234954) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RFC1 (RFC140, Replication Factor C Subunit 1, Activator 1 140kD Subunit, Activator 1 Large Subunit, Activator 1 Subunit 1, DNA-binding Protein PO-GA, Replication Factor C 140kD Subunit, Replication Factor C Large Subunit, MGC51786) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RFC1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RFC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RFC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.