Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Aurora A Monoclonal Antibody | anti-AURA antibody

Aurora A (Serine/Threonine-protein Kinase 6, Aurora Kinase A, Serine/Threonine-protein Kinase Aurora-A, Serine/Threonine-protein Kinase 15, Aurora/IPL1-related Kinase 1, Aurora-related Kinase 1, ARK-1, hARK1, Breast Tumor-amplified Kinase, AURKA, ARK1, AU

Gene Names
AURKA; AIK; ARK1; AURA; BTAK; STK6; STK7; STK15; PPP1R47
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Aurora A; Monoclonal Antibody; Aurora A (Serine/Threonine-protein Kinase 6; Aurora Kinase A; Serine/Threonine-protein Kinase Aurora-A; Serine/Threonine-protein Kinase 15; Aurora/IPL1-related Kinase 1; Aurora-related Kinase 1; ARK-1; hARK1; Breast Tumor-amplified Kinase; AURKA; ARK1; AU; anti-AURA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F8
Specificity
Recognizes human AURKA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
403
Applicable Applications for anti-AURA antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human AURKA (NP_940835) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNP
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-AURA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
aurora kinase A
NCBI Official Synonym Full Names
aurora kinase A
NCBI Official Symbol
AURKA
NCBI Official Synonym Symbols
AIK; ARK1; AURA; BTAK; STK6; STK7; STK15; PPP1R47
NCBI Protein Information
aurora kinase A
UniProt Protein Name
Aurora kinase A
UniProt Gene Name
AURKA
UniProt Synonym Gene Names
AIK; AIRK1; ARK1; AURA; AYK1; BTAK; IAK1; STK15; STK6; ARK-1; Aurora-related kinase 1; hARK1
UniProt Entry Name
AURKA_HUMAN

NCBI Description

The protein encoded by this gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

AurA: a member of the AUR family of kinases. A cell cycle-regulated serine/threonine protein kinase that is overexpressed in many tumor cell lines. Regulated by phosphorylation-dependent proteasomal degradation. Localized to mitotic centrosomes and spindle microtubules and is required for centrosome maturation. Loss of Aurora A leads to defective mitotic spindles and gross errors in chromosome segregation. Required for centrosome duplication and chromosome segregation. Overexpression in culture drives transformation and aneuploidy, and negatively regulates p53. Amplified or overexpressed in many tumors or cell lines. Found as a skin tumor susceptibility gene in mouse, and a human SNP in a degradation domain is weakly cancer-associated and undergoes allele-specific amplification. Inhibitors: VX-680, ZM447439, Hesperadin, SNS-595.

Protein type: Protein kinase, Other; Kinase, protein; Oncoprotein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Other group; AUR family

Chromosomal Location of Human Ortholog: 20q13

Cellular Component: germinal vesicle; centrosome; pronucleus; spindle pole centrosome; cytosol; microtubule cytoskeleton; axon hillock; perinuclear region of cytoplasm; spindle microtubule; spindle; spindle midzone; midbody; nucleus; condensed nuclear chromosome, pericentric region

Molecular Function: protein serine/threonine kinase activity; protein binding; ubiquitin protein ligase binding; protein serine/threonine/tyrosine kinase activity; histone serine kinase activity; protein kinase binding; ATP binding; protein kinase activity

Biological Process: spindle stabilization; mitosis; regulation of centrosome cycle; positive regulation of mitosis; protein amino acid autophosphorylation; regulation of protein stability; regulation of cytokinesis; protein amino acid phosphorylation; mitotic centrosome separation; mitotic spindle organization and biogenesis; centrosome localization; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; cell division; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle; G2/M transition of mitotic cell cycle; negative regulation of protein binding; spindle assembly involved in female meiosis I; negative regulation of apoptosis; anterior/posterior axis specification

Disease: Colorectal Cancer

Research Articles on AURA

Similar Products

Product Notes

The AURA aurka (Catalog #AAA6231715) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Aurora A (Serine/Threonine-protein Kinase 6, Aurora Kinase A, Serine/Threonine-protein Kinase Aurora-A, Serine/Threonine-protein Kinase 15, Aurora/IPL1-related Kinase 1, Aurora-related Kinase 1, ARK-1, hARK1, Breast Tumor-amplified Kinase, AURKA, ARK1, AU reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Aurora A can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AURA aurka for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Aurora A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.