Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse MYO1E Monoclonal Antibody | anti-MYO1E antibody

MYO1E (Myosin IE, HuncM-IC, MGC104638, MYO1C) (MaxLight 650)

Gene Names
MYO1E; FSGS6; MYO1C; HuncM-IC
Applications
Western Blot
Purity
Purified
Synonyms
MYO1E; Monoclonal Antibody; MYO1E (Myosin IE; HuncM-IC; MGC104638; MYO1C) (MaxLight 650); Myosin IE; MYO1C; anti-MYO1E antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7A5
Specificity
Recognizes MYO1E.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-MYO1E antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MYO1E (NP_004989.2, 918aa-1014aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPES
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MYO1E antibody
Mouse monoclonal antibody raised against a partial recombinant MYO1E.
Product Categories/Family for anti-MYO1E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127,062 Da
NCBI Official Full Name
unconventional myosin-Ie
NCBI Official Synonym Full Names
myosin IE
NCBI Official Symbol
MYO1E
NCBI Official Synonym Symbols
FSGS6; MYO1C; HuncM-IC
NCBI Protein Information
unconventional myosin-Ie
UniProt Protein Name
Unconventional myosin-Ie
Protein Family
UniProt Gene Name
MYO1E
UniProt Synonym Gene Names
MYO1C
UniProt Entry Name
MYO1E_HUMAN

NCBI Description

This gene encodes a member of the nonmuscle class I myosins which are a subgroup of the unconventional myosin protein family. The unconventional myosin proteins function as actin-based molecular motors. Class I myosins are characterized by a head (motor) domain, a regulatory domain and a either a short or long tail domain. Among the class I myosins, this protein is distinguished by a long tail domain that is involved in crosslinking actin filaments. This protein localizes to the cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations in this gene are the cause of focal segmental glomerulosclerosis-6. This gene has been referred to as myosin IC in the literature but is distinct from the myosin IC gene located on chromosome 17. [provided by RefSeq, Jan 2012]

Uniprot Description

MYO1E: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. Binds to membranes containing anionic phospholipids via its tail domain. Required for normal morphology of the glomerular basement membrane, normal development of foot processes by kidney podocytes and normal kidney function. In dendritic cells, may control the movement of class II-containing cytoplasmic vesicles along the actin cytoskeleton by connecting them with the actin network via ARL14EP and ARL14. Defects in MYO1E are the cause of focal segmental glomerulosclerosis type 6 (FSGS6). A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and progressive decline in renal function. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation. FSGS6 is a childhood-onset disorder resulting in nephrotic syndrome, which includes massive proteinuria, hypoalbuminemia, hyperlipidemia, and edema.

Protein type: Motor; Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 15q21-q22

Cellular Component: actin cytoskeleton; adherens junction; brush border; clathrin-coated endocytic vesicle; cytoplasm; cytoskeleton; intercellular junction; myosin complex

Molecular Function: actin filament binding; ATP binding; ATPase activity, coupled; calmodulin binding; microfilament motor activity; motor activity; phosphoinositide binding; protein binding

Biological Process: actin filament-based movement; endocytosis; glomerular basement membrane development; glomerular filtration; in utero embryonic development; nitrogen compound metabolic process; platelet-derived growth factor receptor signaling pathway; post-embryonic hemopoiesis; vasculogenesis

Disease: Focal Segmental Glomerulosclerosis 6

Research Articles on MYO1E

Similar Products

Product Notes

The MYO1E myo1e (Catalog #AAA6228847) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MYO1E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYO1E myo1e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYO1E, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.