Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Troponin I Monoclonal Antibody | anti-cTnI antibody

Troponin I, Cardiac (Troponin I Cardiac Muscle, Cardiac Troponin I, TNNC1, TNNI3, CMD1FF, CMD2A, CMH7, cTnI, RCM1) (MaxLight 650)

Gene Names
TNNI3; CMH7; RCM1; cTnI; CMD2A; TNNC1; CMD1FF
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Troponin I; Monoclonal Antibody; Cardiac (Troponin I Cardiac Muscle; Cardiac Troponin I; TNNC1; TNNI3; CMD1FF; CMD2A; CMH7; cTnI; RCM1) (MaxLight 650); anti-cTnI antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E7
Specificity
Recognizes human TNNI3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
843
Applicable Applications for anti-cTnI antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa102-210 of human TNNI3 (NP_000354) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-cTnI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens troponin I3, cardiac type (TNNI3), mRNA
NCBI Official Synonym Full Names
troponin I3, cardiac type
NCBI Official Symbol
TNNI3
NCBI Official Synonym Symbols
CMH7; RCM1; cTnI; CMD2A; TNNC1; CMD1FF
NCBI Protein Information
troponin I, cardiac muscle
UniProt Protein Name
Troponin I, cardiac muscle
Protein Family
UniProt Gene Name
TNNI3
UniProt Synonym Gene Names
TNNC1
UniProt Entry Name
TNNI3_HUMAN

NCBI Description

Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). [provided by RefSeq, Jul 2008]

Uniprot Description

TNNI3: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Binds to actin and tropomyosin. Interacts with TRIM63. Interacts with STK4/MST1. Belongs to the troponin I family.

Protein type: Motility/polarity/chemotaxis; Motor; Actin-binding

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: sarcomere; troponin complex; cytosol

Molecular Function: troponin T binding; protein domain specific binding; troponin C binding; protein binding; metal ion binding; calcium channel inhibitor activity; actin binding; protein kinase binding; calcium-dependent protein binding

Biological Process: regulation of smooth muscle contraction; cellular calcium ion homeostasis; heart contraction; regulation of systemic arterial blood pressure by ischemic conditions; heart development; ventricular cardiac muscle morphogenesis; vasculogenesis; negative regulation of ATPase activity; muscle filament sliding; cardiac muscle contraction

Disease: Cardiomyopathy, Dilated, 1ff; Cardiomyopathy, Familial Restrictive, 1; Cardiomyopathy, Familial Hypertrophic, 7; Cardiomyopathy, Dilated, 2a

Research Articles on cTnI

Similar Products

Product Notes

The cTnI tnni3 (Catalog #AAA6225143) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Troponin I, Cardiac (Troponin I Cardiac Muscle, Cardiac Troponin I, TNNC1, TNNI3, CMD1FF, CMD2A, CMH7, cTnI, RCM1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Troponin I can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the cTnI tnni3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Troponin I, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.