Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human LMO1 Monoclonal Antibody | anti-LMO1 antibody

LMO1 (Rhombotin-1, Cysteine-rich Protein TTG-1, LIM Domain Only Protein 1, LMO-1, T-cell Translocation Protein 1, RBTN1, RHOM1, TTG1, MGC116692) (MaxLight 650)

Gene Names
LMO1; TTG1; RBTN1; RHOM1
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LMO1; Monoclonal Antibody; LMO1 (Rhombotin-1; Cysteine-rich Protein TTG-1; LIM Domain Only Protein 1; LMO-1; T-cell Translocation Protein 1; RBTN1; RHOM1; TTG1; MGC116692) (MaxLight 650); anti-LMO1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F7
Specificity
Recognizes human LMO1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-LMO1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human LMO1 (NP_002306) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-LMO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.2kDa (179aa)
NCBI Official Full Name
rhombotin-1 isoform a
NCBI Official Synonym Full Names
LIM domain only 1
NCBI Official Symbol
LMO1
NCBI Official Synonym Symbols
TTG1; RBTN1; RHOM1
NCBI Protein Information
rhombotin-1
UniProt Protein Name
Rhombotin-1
Protein Family
UniProt Gene Name
LMO1
UniProt Synonym Gene Names
RBTN1; RHOM1; TTG1; LMO-1
UniProt Entry Name
RBTN1_HUMAN

NCBI Description

This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2012]

Uniprot Description

LMO1: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.

Protein type: Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: nucleus

Molecular Function: zinc ion binding

Biological Process: positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter

Research Articles on LMO1

Similar Products

Product Notes

The LMO1 lmo1 (Catalog #AAA6223005) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LMO1 (Rhombotin-1, Cysteine-rich Protein TTG-1, LIM Domain Only Protein 1, LMO-1, T-cell Translocation Protein 1, RBTN1, RHOM1, TTG1, MGC116692) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMO1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMO1 lmo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMO1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.