Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ATR Monoclonal Antibody | anti-ATR antibody

ATR (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (MaxLight 650)

Gene Names
ATR; FRP1; MEC1; SCKL; FCTCS; SCKL1
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATR; Monoclonal Antibody; ATR (Serine/Threonine-protein Kinase ATR; Ataxia Telangiectasia And Rad3-related Protein; FRAP-related Protein 1; FRP1) (MaxLight 650); anti-ATR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F2
Specificity
Recognizes human ATR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-ATR antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2545-2644 from human ATR (NP_001175) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-ATR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
545
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
297,479 Da
NCBI Official Full Name
serine/threonine-protein kinase ATR
NCBI Official Synonym Full Names
ATR serine/threonine kinase
NCBI Official Symbol
ATR
NCBI Official Synonym Symbols
FRP1; MEC1; SCKL; FCTCS; SCKL1
NCBI Protein Information
serine/threonine-protein kinase ATR; FRAP-related protein-1; MEC1, mitosis entry checkpoint 1, homolog; ataxia telangiectasia and Rad3-related protein
UniProt Protein Name
Serine/threonine-protein kinase ATR
Protein Family
UniProt Gene Name
ATR
UniProt Synonym Gene Names
FRP1
UniProt Entry Name
ATR_HUMAN

Uniprot Description

ATR: a ser/thr kinase of the PIKK family most closely related to ATM. Activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]Q. Phosphorylates BRCA1, Chk1, MCM2, RAD17, RPA2, SMC1 and p53, which collectively inhibit DNA replication and mitosis and promote DNA repair, recombination and apoptosis. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at sites of DNA damage, thereby regulating DNA damage response mechanism. Required for FANCD2 ubiquitination. Critical for maintenance of fragile site stability and efficient regulation of centrosome duplication.

Protein type: Kinase, lipid; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Membrane protein, integral; Protein kinase, atypical; Kinase, protein; ATYPICAL group; PIKK family; ATR subfamily

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: XY body; nucleoplasm; Golgi apparatus; PML body; chromosome

Molecular Function: protein dimerization activity; protein serine/threonine kinase activity; protein binding; DNA binding; MutLalpha complex binding; MutSalpha complex binding; ATP binding; protein kinase activity

Biological Process: response to drug; peptidyl-serine phosphorylation; negative regulation of DNA replication; multicellular organismal development; protein amino acid autophosphorylation; regulation of protein binding; DNA damage checkpoint; positive regulation of DNA damage response, signal transduction by p53 class mediator; DNA replication; cell cycle; DNA repair; response to DNA damage stimulus; double-strand break repair via homologous recombination

Disease: Seckel Syndrome 1; Cutaneous Telangiectasia And Cancer Syndrome, Familial

Similar Products

Product Notes

The ATR atr (Catalog #AAA6221034) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATR (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATR can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATR atr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.