Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TLN1 Monoclonal Antibody | anti-TLN1 antibody

TLN1 (Talin 1, TLN, ILWEQ, KIAA1027) (MaxLight 550)

Gene Names
TLN1; TLN; ILWEQ
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TLN1; Monoclonal Antibody; TLN1 (Talin 1; TLN; ILWEQ; KIAA1027) (MaxLight 550); anti-TLN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1A11
Specificity
Recognizes human TLN1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-TLN1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1052-1149 from human TLN1 (NP_006280) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQA
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-TLN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
269,767 Da
NCBI Official Full Name
talin-1
NCBI Official Synonym Full Names
talin 1
NCBI Official Symbol
TLN1
NCBI Official Synonym Symbols
TLN; ILWEQ
NCBI Protein Information
talin-1
UniProt Protein Name
Talin-1
Protein Family
UniProt Gene Name
TLN1
UniProt Synonym Gene Names
KIAA1027; TLN
UniProt Entry Name
TLN1_HUMAN

Uniprot Description

Talin-1: a cytoskeletal protein which is concentrated in areas of cell-substratum and cell-cell contacts. This protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: ruffle; cell surface; focal adhesion; cytoplasm; plasma membrane; extracellular region; microtubule organizing center; intercellular junction; cytosol

Molecular Function: integrin binding; actin filament binding; LIM domain binding; protein binding; structural constituent of cytoskeleton; insulin receptor binding; vinculin binding

Biological Process: intercellular junction assembly; axon guidance; platelet activation; unfolded protein response; cytoskeletal anchoring; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; platelet degranulation; muscle contraction; cell-substrate junction assembly; cortical actin cytoskeleton organization and biogenesis; cell motility; blood coagulation

Similar Products

Product Notes

The TLN1 tln1 (Catalog #AAA6214431) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TLN1 (Talin 1, TLN, ILWEQ, KIAA1027) (MaxLight 550) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TLN1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TLN1 tln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TLN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.