Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Siglec 10 Monoclonal Antibody | anti-SIGLEC10 antibody

Siglec 10 (Sialic Acid-binding Ig-like Lectin 10, Siglec like Protein 2, SLG2, UNQ477, PRO940) (MaxLight 490)

Gene Names
SIGLEC10; SLG2; PRO940; SIGLEC-10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Siglec 10; Monoclonal Antibody; Siglec 10 (Sialic Acid-binding Ig-like Lectin 10; Siglec like Protein 2; SLG2; UNQ477; PRO940) (MaxLight 490); anti-SIGLEC10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D11
Specificity
Recognizes human SIGLEC10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-SIGLEC10 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa589-697 from human SIGLEC10 (NP_149121) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SIGLEC10 antibody
Siglecs (sialic acid binding Ig-like lectins) are I-type lectins that belong to the immunoglobulin superfamily. They are characterized by a V-type-Ig-like domain which mediates sialic acid binding, followed by varying numbers of C2-type Ig-like domains. Mouse Siglec-G, the apparent ortholog of human Siglec-10, is a 110-120kD, 688 amino acid (aa) type I transmembrane protein mainly expressed on mouse B1-type B cells. It controls B1 cell survival, selection, expansion and calcium signaling by negatively regulating B cell receptor signals. A potentially secreted 269aa variant diverges after the first two Ig-like domains. Mouse Siglec-G shares ~63% aa sequence identity with human Siglec-10 within the extracellular domain.
Product Categories/Family for anti-SIGLEC10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
sialic acid-binding Ig-like lectin 10 isoform 1
NCBI Official Synonym Full Names
sialic acid binding Ig like lectin 10
NCBI Official Symbol
SIGLEC10
NCBI Official Synonym Symbols
SLG2; PRO940; SIGLEC-10
NCBI Protein Information
sialic acid-binding Ig-like lectin 10
UniProt Protein Name
Sialic acid-binding Ig-like lectin 10
UniProt Gene Name
SIGLEC10
UniProt Synonym Gene Names
SLG2; Siglec-10
UniProt Entry Name
SIG10_HUMAN

NCBI Description

SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM, Jul 2002]

Uniprot Description

Siglec-10: a cell surface protein belonging to the immunoglobulin superfamily and the SIGLEC (sialic acid binding Ig-like lectin) family. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Five alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: plasma membrane; integral to membrane; extracellular region

Molecular Function: carbohydrate binding

Biological Process: cell adhesion

Research Articles on SIGLEC10

Similar Products

Product Notes

The SIGLEC10 siglec10 (Catalog #AAA6203289) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Siglec 10 (Sialic Acid-binding Ig-like Lectin 10, Siglec like Protein 2, SLG2, UNQ477, PRO940) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Siglec 10 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SIGLEC10 siglec10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Siglec 10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.