Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MYH3 Monoclonal Antibody | anti-MYH3 antibody

MYH3 (Myosin-3, Muscle Embryonic Myosin Heavy Chain, Myosin Heavy Chain 3, Myosin Heavy Chain, Fast Skeletal Muscle, Embryonic, SMHCE) (MaxLight 490)

Gene Names
MYH3; HEMHC; SMHCE; MYHSE1; MYHC-EMB
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYH3; Monoclonal Antibody; MYH3 (Myosin-3; Muscle Embryonic Myosin Heavy Chain; Myosin Heavy Chain 3; Myosin Heavy Chain; Fast Skeletal Muscle; Embryonic; SMHCE) (MaxLight 490); anti-MYH3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H3
Specificity
Recognizes human MYH3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-MYH3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-100 from human MYH3 (NP_002461.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MYH3 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-MYH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
223,905 Da
NCBI Official Full Name
myosin-3
NCBI Official Synonym Full Names
myosin, heavy chain 3, skeletal muscle, embryonic
NCBI Official Symbol
MYH3
NCBI Official Synonym Symbols
HEMHC; SMHCE; MYHSE1; MYHC-EMB
NCBI Protein Information
myosin-3; myosin, skeletal, heavy chain, embryonic 1; myosin heavy chain, fast skeletal muscle, embryonic; myosin, heavy polypeptide 3, skeletal muscle, embryonic
UniProt Protein Name
Myosin-3
UniProt Gene Name
MYH3
UniProt Entry Name
MYH3_HUMAN

NCBI Description

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

MYH3: Muscle contraction. Defects in MYH3 are the cause of distal arthrogryposis type 2A (DA2A); also known as Freeman-Sheldon syndrome (FSS). Distal arthrogryposis is a clinically and genetically heterogeneous group of disorders characterized by bone anomalies and joint contractures of the hands and feet, causing medially overlapping fingers, clenched fists, ulnar deviation of fingers, camptodactyly and positional foot deformities. It is a disorder of primary limb malformation without primary neurologic or muscle disease. DA2A is the most severe form of distal arthrogryposis. Affected individuals have contractures of the orofacial muscles, characterized by microstomia with pouting lips, H-shaped dimpling of the chin, deep nasolabial folds, and blepharophimosis. Dysphagia, failure to thrive, growth deficit, and life-threatening respiratory complications (caused by structural anomalies of the oropharynx and upper airways) are frequent. Inheritance is autosomal dominant. Defects in MYH3 are the cause of distal arthrogryposis type 2B (DA2B); also known as Sheldon-Hall syndrome (SHS) or arthrogryposis multiplex congenita distal type 2B (AMCD2B). DA2B is a form of inherited multiple congenital contractures. Affected individuals have vertical talus, ulnar deviation in the hands, severe camptodactyly, and a distinctive face characterized by a triangular shape, prominent nasolabial folds, small mouth and a prominent chin. DA2B is the most common of the distal arthrogryposis syndromes. It is similar to DA2A but the facial contractures are less dramatic.

Protein type: Motor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: sarcomere; muscle myosin complex; cytosol

Molecular Function: microfilament motor activity; calmodulin binding; actin filament binding; ATPase activity, coupled; ATP binding

Biological Process: skeletal muscle contraction; muscle development; actin filament-based movement; metabolic process; sarcomere organization; muscle filament sliding; embryonic limb morphogenesis

Disease: Arthrogryposis, Distal, Type 8; Arthrogryposis, Distal, Type 2a; Arthrogryposis, Distal, Type 2b

Research Articles on MYH3

Similar Products

Product Notes

The MYH3 myh3 (Catalog #AAA6201982) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYH3 (Myosin-3, Muscle Embryonic Myosin Heavy Chain, Myosin Heavy Chain 3, Myosin Heavy Chain, Fast Skeletal Muscle, Embryonic, SMHCE) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYH3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYH3 myh3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYH3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.