Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human LSM1 Monoclonal Antibody | anti-LSM1 antibody

LSM1 (U6 snRNA-associated Sm-like Protein LSm1, Cancer-associated Sm-like, Small Nuclear Ribonuclear CaSm, CASM) (MaxLight 490)

Gene Names
LSM1; CASM; YJL124C
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LSM1; Monoclonal Antibody; LSM1 (U6 snRNA-associated Sm-like Protein LSm1; Cancer-associated Sm-like; Small Nuclear Ribonuclear CaSm; CASM) (MaxLight 490); anti-LSM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F7
Specificity
Recognizes human LSM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-LSM1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa34-134 from human LSM1 (NP_055277) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-LSM1 antibody
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Product Categories/Family for anti-LSM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.3kDa (153aa), confirmed by MALDI-TOF
NCBI Official Full Name
U6 snRNA-associated Sm-like protein LSm1
NCBI Official Synonym Full Names
LSM1 homolog, mRNA degradation associated
NCBI Official Symbol
LSM1
NCBI Official Synonym Symbols
CASM; YJL124C
NCBI Protein Information
U6 snRNA-associated Sm-like protein LSm1
UniProt Protein Name
U6 snRNA-associated Sm-like protein LSm1
Protein Family
UniProt Gene Name
LSM1
UniProt Synonym Gene Names
CASM
UniProt Entry Name
LSM1_HUMAN

NCBI Description

This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011]

Uniprot Description

LSM1: Plays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA. Belongs to the snRNP Sm proteins family.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 8p11.2

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: protein binding; RNA cap binding

Biological Process: RNA splicing, via transesterification reactions; deadenylation-dependent decapping; RNA splicing; gene expression; mRNA processing; mRNA catabolic process, deadenylation-dependent decay

Research Articles on LSM1

Similar Products

Product Notes

The LSM1 lsm1 (Catalog #AAA6201692) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LSM1 (U6 snRNA-associated Sm-like Protein LSm1, Cancer-associated Sm-like, Small Nuclear Ribonuclear CaSm, CASM) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LSM1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LSM1 lsm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LSM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.