Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MAPK1 Monoclonal Antibody | anti-MAPK1 antibody

MAPK1 (Mitogen-activated Protein Kinase 1, OTTHUMP00000174492, Extracellular Signal-regulated Kinase 2, Extracellular Signal-regulated Kinase-2, Mitogen-activated Protein Kinase 2, Protein Tyrosine Kinase ERK2, ERK, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM

Gene Names
MAPK1; ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MAPK1; Monoclonal Antibody; MAPK1 (Mitogen-activated Protein Kinase 1; OTTHUMP00000174492; Extracellular Signal-regulated Kinase 2; Extracellular Signal-regulated Kinase-2; Mitogen-activated Protein Kinase 2; Protein Tyrosine Kinase ERK2; ERK; ERK2; ERT1; MAPK2; P42MAPK; PRKM1; PRKM; anti-MAPK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D1
Specificity
Recognizes human MAPK1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
360
Applicable Applications for anti-MAPK1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa261-360 from full-length human MAPK1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MAPK1 antibody
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
Product Categories/Family for anti-MAPK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Mitogen-activated protein kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 1
NCBI Official Symbol
MAPK1
NCBI Official Synonym Symbols
ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
NCBI Protein Information
mitogen-activated protein kinase 1

NCBI Description

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

Research Articles on MAPK1

Similar Products

Product Notes

The MAPK1 (Catalog #AAA6194205) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPK1 (Mitogen-activated Protein Kinase 1, OTTHUMP00000174492, Extracellular Signal-regulated Kinase 2, Extracellular Signal-regulated Kinase-2, Mitogen-activated Protein Kinase 2, Protein Tyrosine Kinase ERK2, ERK, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.