Mouse anti-Human Siglec 10 Monoclonal Antibody | anti-SIGLEC10 antibody

Siglec 10 (Sialic Acid-binding Ig-like Lectin 10, Siglec like Protein 2, SLG2, UNQ477, PRO940) (MaxLight 405)

Cat. Num. AAA6192614

• Gene Names: SIGLEC10; SLG2; PRO940; SIGLEC-10
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Siglec 10; Monoclonal Antibody; Siglec 10 (Sialic Acid-binding Ig-like Lectin 10; Siglec like Protein 2; SLG2; UNQ477; PRO940) (MaxLight 405); anti-SIGLEC10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D11
• Specificity: Recognizes human SIGLEC10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

• Applicable Applications for anti-SIGLEC10 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa589-697 from human SIGLEC10 (NP_149121) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-SIGLEC10 antibody

Siglecs (sialic acid binding Ig-like lectins) are I-type lectins that belong to the immunoglobulin superfamily. They are characterized by a V-type-Ig-like domain which mediates sialic acid binding, followed by varying numbers of C2-type Ig-like domains. Mouse Siglec-G, the apparent ortholog of human Siglec-10, is a 110-120kD, 688 amino acid (aa) type I transmembrane protein mainly expressed on mouse B1-type B cells. It controls B1 cell survival, selection, expansion and calcium signaling by negatively regulating B cell receptor signals. A potentially secreted 269aa variant diverges after the first two Ig-like domains. Mouse Siglec-G shares ~63% aa sequence identity with human Siglec-10 within the extracellular domain.

Product Categories/Family for anti-SIGLEC10 antibody

Antibodies; Lectins

NCBI and Uniprot Product Information

• NCBI GI #: 31377639
• NCBI GeneID: 89790
• NCBI Accession #: NP_149121
• NCBI GenBank Nucleotide #: NM_033130
• UniProt Accession #: Q96LC7
• Molecular Weight: 76kDa
• NCBI Official Full Name: sialic acid-binding Ig-like lectin 10 isoform 1
• NCBI Official Synonym Full Names: sialic acid binding Ig like lectin 10
• NCBI Official Symbol: SIGLEC10
• NCBI Official Synonym Symbols: SLG2; PRO940; SIGLEC-10
• NCBI Protein Information: sialic acid-binding Ig-like lectin 10
• UniProt Protein Name: Sialic acid-binding Ig-like lectin 10
• Protein Family: Sialic acid-binding Ig-like lectin
• UniProt Gene Name: SIGLEC10
• UniProt Synonym Gene Names: SLG2; Siglec-10
• UniProt Entry Name: SIG10_HUMAN

NCBI Description

SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM, Jul 2002]

Uniprot Description

Siglec-10: a cell surface protein belonging to the immunoglobulin superfamily and the SIGLEC (sialic acid binding Ig-like lectin) family. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Five alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: plasma membrane; integral to membrane; extracellular region

Molecular Function: carbohydrate binding

Biological Process: cell adhesion