Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DTX3 Monoclonal Antibody | anti-DTX3 antibody

DTX3 (RNF154, Probable E3 Ubiquitin-protein Ligase DTX3, Protein Deltex-3, RING Finger Protein 154, FLJ34766, MGC138863, MGC138864) (MaxLight 405)

Gene Names
DTX3; RNF154; deltex3
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DTX3; Monoclonal Antibody; DTX3 (RNF154; Probable E3 Ubiquitin-protein Ligase DTX3; Protein Deltex-3; RING Finger Protein 154; FLJ34766; MGC138863; MGC138864) (MaxLight 405); anti-DTX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3, lambda
Clone Number
4F10
Specificity
Recognizes human DTX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
347
Applicable Applications for anti-DTX3 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa201-301 from human DTX3 (NP_848597) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DTX3 antibody
DTX3 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).
Product Categories/Family for anti-DTX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
probable E3 ubiquitin-protein ligase DTX3 isoform a
NCBI Official Synonym Full Names
deltex E3 ubiquitin ligase 3
NCBI Official Symbol
DTX3
NCBI Official Synonym Symbols
RNF154; deltex3
NCBI Protein Information
probable E3 ubiquitin-protein ligase DTX3
UniProt Protein Name
Probable E3 ubiquitin-protein ligase DTX3
Protein Family
UniProt Gene Name
DTX3
UniProt Synonym Gene Names
RNF154; Deltex3
UniProt Entry Name
DTX3_HUMAN

NCBI Description

DTX3 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009]

Uniprot Description

DTX3: Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity. Belongs to the Deltex family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; EC 6.3.2.-; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: cytoplasm

Molecular Function: zinc ion binding; ligase activity

Biological Process: Notch signaling pathway; protein ubiquitination

Research Articles on DTX3

Similar Products

Product Notes

The DTX3 dtx3 (Catalog #AAA6189876) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DTX3 (RNF154, Probable E3 Ubiquitin-protein Ligase DTX3, Protein Deltex-3, RING Finger Protein 154, FLJ34766, MGC138863, MGC138864) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DTX3 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DTX3 dtx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DTX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.