Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RAB36 blocking peptide

RAB36 Peptide - middle region

Reactivity
Human
Synonyms
RAB36; RAB36 Peptide - middle region; RAB36 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEA
Sequence Length
333
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RAB36 blocking peptide
This is a synthetic peptide designed for use in combination with anti- RAB36 Antibody, made

Target Description: Protein transport. Probably involved in vesicular traffic (By similarity).
Product Categories/Family for RAB36 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Synonym Full Names
RAB36, member RAS oncogene family
NCBI Official Symbol
RAB36
NCBI Protein Information
ras-related protein Rab-36
UniProt Protein Name
Ras-related protein Rab-36
Protein Family
UniProt Gene Name
RAB36
UniProt Entry Name
RAB36_HUMAN

Uniprot Description

RAB36: Protein transport. Probably involved in vesicular traffic. Belongs to the small GTPase superfamily. Rab family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric; G protein, monomeric, Rab; G protein

Chromosomal Location of Human Ortholog: 22q11.22

Cellular Component: Golgi membrane; Golgi apparatus

Molecular Function: GTPase activity; GDP binding; GTP binding

Biological Process: intracellular protein transport; metabolic process; Rab protein signal transduction

Research Articles on RAB36

Similar Products

Product Notes

The RAB36 rab36 (Catalog #AAA3247464) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RAB36 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: FDLTDVQTLE HTRQWLEDAL RENEAGSCFI FLVGTKKDLL SGAACEQAEA. It is sometimes possible for the material contained within the vial of "RAB36, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.