Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NME3 blocking peptide

NME3 Peptide - N-terminal region

Gene Names
NME3; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2
Reactivity
Human
Synonyms
NME3; NME3 Peptide - N-terminal region; NME3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKL
Sequence Length
169
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NME3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- NME3 Antibody, made

Target Description: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.
Product Categories/Family for NME3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
nucleoside diphosphate kinase 3
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 3
NCBI Official Symbol
NME3
NCBI Official Synonym Symbols
NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2
NCBI Protein Information
nucleoside diphosphate kinase 3
UniProt Protein Name
Nucleoside diphosphate kinase 3
UniProt Gene Name
NME3
UniProt Synonym Gene Names
NDK 3; NDP kinase 3; NDPKC
UniProt Entry Name
NDK3_HUMAN

Uniprot Description

NME3: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis. Belongs to the NDK family.

Protein type: Kinase, other; Kinase, nucleoside diphosphate; Nucleotide Metabolism - pyrimidine; EC 2.7.4.6; Apoptosis; Motility/polarity/chemotaxis; Nucleotide Metabolism - purine; Other group; NDK family

Chromosomal Location of Human Ortholog: 16q13.3

Cellular Component: mitochondrion; cytosol

Molecular Function: metal ion binding; nucleoside diphosphate kinase activity; ATP binding

Biological Process: GTP biosynthetic process; regulation of apoptosis; CTP biosynthetic process; apoptosis; pyrimidine nucleotide metabolic process; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process

Research Articles on NME3

Similar Products

Product Notes

The NME3 nme3 (Catalog #AAA3247168) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NME3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLVLTIFANL FPAACTGAHE RTFLAVKPDG VQRRLVGEIV RRFERKGFKL. It is sometimes possible for the material contained within the vial of "NME3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.