Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EEF1D blocking peptide

EEF1D Peptide - middle region

Gene Names
EEF1D; EF1D; EF-1D; FP1047
Reactivity
Human
Synonyms
EEF1D; EEF1D Peptide - middle region; EEF1D blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQL
Sequence Length
281
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EEF1D blocking peptide
This is a synthetic peptide designed for use in combination with anti- EEF1D Antibody, made

Target Description: This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.
Product Categories/Family for EEF1D blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
elongation factor 1-delta isoform 1
NCBI Official Synonym Full Names
eukaryotic translation elongation factor 1 delta
NCBI Official Symbol
EEF1D
NCBI Official Synonym Symbols
EF1D; EF-1D; FP1047
NCBI Protein Information
elongation factor 1-delta
UniProt Protein Name
Elongation factor 1-delta
Protein Family
UniProt Gene Name
EEF1D
UniProt Synonym Gene Names
EF1D; EF-1-delta
UniProt Entry Name
EF1D_HUMAN

NCBI Description

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.[provided by RefSeq, Aug 2010]

Uniprot Description

EEF1D: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP. Belongs to the EF-1-beta/EF-1-delta family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation elongation; Translation

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: eukaryotic translation elongation factor 1 complex; endoplasmic reticulum; cytoplasm; nucleolus; nucleus; cytosol

Molecular Function: signal transducer activity; protein binding; transcription activator binding; DNA binding; translation factor activity, nucleic acid binding; heat shock protein binding; translation elongation factor activity

Biological Process: cellular protein metabolic process; translational elongation; positive regulation of I-kappaB kinase/NF-kappaB cascade; regulation of transcription, DNA-dependent; translation; transcription, DNA-dependent; mRNA transcription; gene expression; signal transduction

Research Articles on EEF1D

Similar Products

Product Notes

The EEF1D eef1d (Catalog #AAA3246705) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EEF1D Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAPQTQHVSP MRQVEPPAKK PATPAEDDED DDIDLFGSDN EEEDKEAAQL. It is sometimes possible for the material contained within the vial of "EEF1D, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.