Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SEC22B blocking peptide

SEC22B Peptide - N-terminal region

Gene Names
SEC22B; ERS-24; SEC22L1
Reactivity
Human
Synonyms
SEC22B; SEC22B Peptide - N-terminal region; SEC22B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTL
Sequence Length
215
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SEC22B blocking peptide
This is a synthetic peptide designed for use in combination with anti- SEC22B Antibody, made

Target Description: The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.
Product Categories/Family for SEC22B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
vesicle-trafficking protein SEC22b
NCBI Official Synonym Full Names
SEC22 homolog B, vesicle trafficking protein (gene/pseudogene)
NCBI Official Symbol
SEC22B
NCBI Official Synonym Symbols
ERS-24; SEC22L1
NCBI Protein Information
vesicle-trafficking protein SEC22b
UniProt Protein Name
Vesicle-trafficking protein SEC22b
UniProt Gene Name
SEC22B
UniProt Synonym Gene Names
SEC22L1; ERS-24; ERS24
UniProt Entry Name
SC22B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

SEC22B: SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER. Belongs to the synaptobrevin family.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; integral to membrane; ER-Golgi intermediate compartment; melanosome

Molecular Function: protein binding; syntaxin binding

Biological Process: ER to Golgi vesicle-mediated transport; protein transport; positive regulation of protein catabolic process; regulation of organelle organization and biogenesis

Research Articles on SEC22B

Similar Products

Product Notes

The SEC22B sec22b (Catalog #AAA3246584) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SEC22B Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMIARVADGL PLAASMQEDE QSGRDLQQYQ SQAKQLFRKL NEQSPTRCTL. It is sometimes possible for the material contained within the vial of "SEC22B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.