Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EEF2 blocking peptide

EEF2 Peptide - N-terminal region

Gene Names
EEF2; EF2; EF-2; EEF-2; SCA26
Reactivity
Human
Synonyms
EEF2; EEF2 Peptide - N-terminal region; EEF2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKVFDAIMNFK
Sequence Length
858
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EEF2 blocking peptide
This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
Product Categories/Family for EEF2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
elongation factor 2
NCBI Official Synonym Full Names
eukaryotic translation elongation factor 2
NCBI Official Symbol
EEF2
NCBI Official Synonym Symbols
EF2; EF-2; EEF-2; SCA26
NCBI Protein Information
elongation factor 2
UniProt Protein Name
Elongation factor 2
Protein Family
UniProt Gene Name
EEF2
UniProt Synonym Gene Names
EF2; EF-2
UniProt Entry Name
EF2_HUMAN

NCBI Description

This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. [provided by RefSeq, Jul 2008]

Uniprot Description

EEF2: a member of the GTP-binding translation elongation factor family. An essential factor for protein synthesis. Promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by eEF2 kinase phosphorylation. eEF2 kinase is normally dependent on Ca2+ ions and calmodulin. eEF2 kinase can also be activated by PKA in response to elevated cAMP levels, which are generally increased in stress- or starvation-related conditions. A variety of treatments known to raise intracellular Ca2+ or cAMP levels have been shown to result in increased phosphorylation of eEF2, and thus to inhibit peptide-chain elongation.

Protein type: Translation elongation; Translation

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: polysome; membrane; cytoplasm; plasma membrane; nucleus; cytosol; ribonucleoprotein complex

Molecular Function: GTPase activity; protein binding; GTP binding; protein kinase binding; translation elongation factor activity

Biological Process: cellular protein metabolic process; translational elongation; positive regulation of translation; translation; peptidyl-diphthamide biosynthetic process from peptidyl-histidine; pathogenesis; gene expression; hemopoietic progenitor cell differentiation; post-translational protein modification

Disease: Spinocerebellar Ataxia 26

Research Articles on EEF2

Similar Products

Product Notes

The EEF2 eef2 (Catalog #AAA3245064) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EEF2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLWGDRYFDP ANGKFSKSAT SPEGKKLPRT FCQLILDPIF KVFDAIMNFK. It is sometimes possible for the material contained within the vial of "EEF2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.