Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RAB33A blocking peptide

RAB33A Peptide - C-terminal region

Gene Names
RAB33A; RabS10
Reactivity
Human
Synonyms
RAB33A; RAB33A Peptide - C-terminal region; RAB33A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSC
Sequence Length
237
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RAB33A blocking peptide
The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport.
Product Categories/Family for RAB33A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
ras-related protein Rab-33A
NCBI Official Synonym Full Names
RAB33A, member RAS oncogene family
NCBI Official Symbol
RAB33A
NCBI Official Synonym Symbols
RabS10
NCBI Protein Information
ras-related protein Rab-33A
UniProt Protein Name
Ras-related protein Rab-33A
Protein Family
UniProt Gene Name
RAB33A
UniProt Synonym Gene Names
RABS10
UniProt Entry Name
RB33A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport. [provided by RefSeq, Jul 2008]

Uniprot Description

RAB33A: belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport. [provided by RefSeq, Jul 2008]

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: Golgi apparatus; plasma membrane

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: intracellular protein transport; antigen processing and presentation; metabolic process; Rab protein signal transduction

Research Articles on RAB33A

Similar Products

Product Notes

The RAB33A rab33a (Catalog #AAA3244812) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RAB33A Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: KESQNVESIF MCLACRLKAQ KSLLYRDAER QQGKVQKLEF PQEANSKTSC. It is sometimes possible for the material contained within the vial of "RAB33A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.