Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SNRPE blocking peptide

SNRPE Peptide - N-terminal region

Gene Names
SNRPE; SME; Sm-E; HYPT11; snRNP-E
Reactivity
Human
Applications
Western Blot
Synonyms
SNRPE; SNRPE Peptide - N-terminal region; SNRPE blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
AYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFD
Sequence Length
92
Applicable Applications for SNRPE blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SNRPE blocking peptide
This is a synthetic peptide designed for use in combination with anti-SNRPE Antibody, made

Target Description: SNRPE appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.
Product Categories/Family for SNRPE blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
small nuclear ribonucleoprotein E isoform 1
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein polypeptide E
NCBI Official Symbol
SNRPE
NCBI Official Synonym Symbols
SME; Sm-E; HYPT11; snRNP-E
NCBI Protein Information
small nuclear ribonucleoprotein E
UniProt Protein Name
Small nuclear ribonucleoprotein E
UniProt Gene Name
SNRPE
UniProt Synonym Gene Names
snRNP-E; Sm-E; SmE
UniProt Entry Name
RUXE_HUMAN

NCBI Description

The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. [provided by RefSeq, Jun 2016]

Uniprot Description

snRNP E: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. Belongs to the snRNP Sm proteins family.

Protein type: RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: nucleoplasm; small nuclear ribonucleoprotein complex; spliceosome; U4/U6 x U5 tri-snRNP complex; snRNP U5; snRNP U2; snRNP U1; nucleus; cytosol; U12-dependent spliceosome

Molecular Function: protein binding; RNA binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; spliceosomal snRNP biogenesis; RNA splicing; spliceosome assembly; histone mRNA metabolic process; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription; hair cycle

Disease: Hypotrichosis 11

Research Articles on SNRPE

Similar Products

Product Notes

The SNRPE snrpe (Catalog #AAA3240815) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SNRPE Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNRPE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNRPE snrpe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AYRGQGQKVQ KVMVQPINLI FRYLQNRSRI QVWLYEQVNM RIEGCIIGFD. It is sometimes possible for the material contained within the vial of "SNRPE, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.