Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SNAPC5 blocking peptide

SNAPC5 Peptide - N-terminal region

Gene Names
SNAPC5; SNAP19
Reactivity
Human
Applications
Western Blot
Synonyms
SNAPC5; SNAPC5 Peptide - N-terminal region; SNAPC5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH
Sequence Length
98
Applicable Applications for SNAPC5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SNAPC5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SNAPC5 Antibody, made

Target Description: SNAPC5 is the part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC5 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
Product Categories/Family for SNAPC5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
snRNA-activating protein complex subunit 5 isoform 1
NCBI Official Synonym Full Names
small nuclear RNA activating complex polypeptide 5
NCBI Official Symbol
SNAPC5
NCBI Official Synonym Symbols
SNAP19
NCBI Protein Information
snRNA-activating protein complex subunit 5
UniProt Protein Name
snRNA-activating protein complex subunit 5
UniProt Gene Name
SNAPC5
UniProt Synonym Gene Names
SNAP19
UniProt Entry Name
SNPC5_HUMAN

NCBI Description

This gene encodes a subunit of the small nuclear RNA (snRNA)-activating protein complex that plays a role in the transcription of snRNA genes. This complex binds to the promoters of snRNA genes transcribed by either RNA polymerase II or III and recruits other regulatory factors to activate snRNA gene transcription. The encoded protein may play a role in stabilizing this complex. A pseudogene of this gene has been identified on chromosome 6. [provided by RefSeq, Jul 2016]

Uniprot Description

SNAPC5: Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; transcription from RNA polymerase III promoter; transcription initiation from RNA polymerase III promoter; regulation of transcription, DNA-dependent; gene expression

Research Articles on SNAPC5

Similar Products

Product Notes

The SNAPC5 snapc5 (Catalog #AAA3238580) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SNAPC5 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNAPC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNAPC5 snapc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KEEETLLRLK AALHDQLNRL KVEELALQSM ISSRRGDEML SSHTVPEQSH. It is sometimes possible for the material contained within the vial of "SNAPC5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.