Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ELAVL2 blocking peptide

ELAVL2 Peptide - N-terminal region

Gene Names
ELAVL2; HUB; HELN1; HEL-N1
Reactivity
Human
Applications
Western Blot
Synonyms
ELAVL2; ELAVL2 Peptide - N-terminal region; ELAVL2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNM
Sequence Length
359
Applicable Applications for ELAVL2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ELAVL2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ELAVL2 Antibody, made

Target Description: The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognize a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for ELAVL2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
ELAV-like protein 2 isoform a
NCBI Official Synonym Full Names
ELAV like RNA binding protein 2
NCBI Official Symbol
ELAVL2
NCBI Official Synonym Symbols
HUB; HELN1; HEL-N1
NCBI Protein Information
ELAV-like protein 2
UniProt Protein Name
ELAV-like protein 2
Protein Family
UniProt Gene Name
ELAVL2
UniProt Synonym Gene Names
HUB; HuB
UniProt Entry Name
ELAV2_HUMAN

NCBI Description

The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognize a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

ELAVL2: Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR. Belongs to the RRM elav family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 9p21

Molecular Function: protein binding; mRNA 3'-UTR binding; nucleotide binding

Biological Process: regulation of transcription, DNA-dependent

Research Articles on ELAVL2

Similar Products

Product Notes

The ELAVL2 elavl2 (Catalog #AAA3230251) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ELAVL2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELAVL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELAVL2 elavl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: METQLSNGPT CNNTANGPTT INNNCSSPVD SGNTEDSKTN LIVNYLPQNM. It is sometimes possible for the material contained within the vial of "ELAVL2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.