Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human NGDN Polyclonal Antibody | anti-NGDN antibody

NGDN Antibody - middle region

Gene Names
NGDN; NGD; LCP5; CANu1; lpd-2; C14orf120
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NGDN; Polyclonal Antibody; NGDN Antibody - middle region; anti-NGDN antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HPHVTRQSQEDQHRINYEESMMVRLSVSKREKGRRKRANVMSSQLHSLTH
Sequence Length
315
Applicable Applications for anti-NGDN antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NGDN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NGDNSample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-NGDN antibody
Neuroguidin is an EIF4E-binding protein that interacts with CPEB and functions as a translational regulatory protein during development of the vertebrate nervous system.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
neuroguidin isoform 1
NCBI Official Synonym Full Names
neuroguidin
NCBI Official Symbol
NGDN
NCBI Official Synonym Symbols
NGD; LCP5; CANu1; lpd-2; C14orf120
NCBI Protein Information
neuroguidin
UniProt Protein Name
Neuroguidin
Protein Family
UniProt Gene Name
NGDN
UniProt Synonym Gene Names
C14orf120; CANu1
UniProt Entry Name
NGDN_HUMAN

NCBI Description

Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).[supplied by OMIM, Mar 2008]

Uniprot Description

NGDN: Involved in the translational repression of cytoplasmic polyadenylation element (CPE)-containing mRNAs. Belongs to the SAS10 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; RNA-binding; Translation

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: small subunit processome; axon; cytoplasm; dendrite; nucleolus; chromosome, pericentric region; filopodium

Biological Process: regulation of translation; maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Research Articles on NGDN

Similar Products

Product Notes

The NGDN ngdn (Catalog #AAA3224138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NGDN Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NGDN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NGDN ngdn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HPHVTRQSQE DQHRINYEES MMVRLSVSKR EKGRRKRANV MSSQLHSLTH. It is sometimes possible for the material contained within the vial of "NGDN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual