Western Blot (WB)
(WB Suggested Anti-ZFP90 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Rabbit anti-Human ZFP90 Polyclonal Antibody | anti-ZFP90 antibody
ZFP90 antibody - middle region
Gene Names
ZFP90; FIK; NK10; ZNF756; zfp-90
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZFP90; Polyclonal Antibody; ZFP90 antibody - middle region; anti-ZFP90 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEECGGAQSLGNCDQVLRGYQVSKPEVIFKLEQGEEPWISEGEIQRPFYP
Sequence Length
821
Applicable Applications for anti-ZFP90 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZFP90
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZFP90 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-ZFP90 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Related Product Information for anti-ZFP90 antibody
This is a rabbit polyclonal antibody against ZFP90. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZFP90 may function as a repressor or silencer protein, and most likely exerts its repressing activity upon zinc-dependent binding to DNA. It may be involved in proper spermatogenesis by repressing the expression of genes unnecessary or incompatible with the maintenance of a haploid cell state.
Target Description: ZFP90 may function as a repressor or silencer protein, and most likely exerts its repressing activity upon zinc-dependent binding to DNA. It may be involved in proper spermatogenesis by repressing the expression of genes unnecessary or incompatible with the maintenance of a haploid cell state.
Product Categories/Family for anti-ZFP90 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Synonym Full Names
ZFP90 zinc finger protein
NCBI Official Symbol
ZFP90
NCBI Official Synonym Symbols
FIK; NK10; ZNF756; zfp-90
NCBI Protein Information
zinc finger protein 90 homolog
UniProt Protein Name
Zinc finger protein 90 homolog
Protein Family
UniProt Gene Name
ZFP90
UniProt Synonym Gene Names
KIAA1954; ZNF756; Zfp-90
UniProt Entry Name
ZFP90_HUMAN
NCBI Description
This gene encodes a member of the zinc finger protein family that modulates gene expression. The encoded protein derepresses the transcription of certain fetal cardiac genes and may contribute to the genetic reprogramming that occurs during the development of heart failure. Genome wide association studies have identified this gene among ulcerative colitis risk loci. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Mar 2015]
Research Articles on ZFP90
Similar Products
Product Notes
The ZFP90 zfp90 (Catalog #AAA3200498) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP90 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP90 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZFP90 zfp90 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEECGGAQSL GNCDQVLRGY QVSKPEVIFK LEQGEEPWIS EGEIQRPFYP. It is sometimes possible for the material contained within the vial of "ZFP90, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
