Interferon regulatory factor 4 (Irf4) Recombinant Protein | Irf4 recombinant protein
Recombinant Mouse Interferon regulatory factor 4 (Irf4)
Gene Names
Irf4; Spip; IRF-4; LSIRF; NF-EM5; AI385587
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon regulatory factor 4 (Irf4); Recombinant Mouse Interferon regulatory factor 4 (Irf4); Irf4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-450, full length protein
Sequence
MNLETGSRGSEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLDDTQMAMGHPYPMTAPYGSLPAQQVHNYMMPPHDRSWRDYAPDQSHPEIPYQCPVTFGPRGHHWQGPSCENGCQVTGTFYACAPPESQAPGIPIEPSIRSAEALALSDCRLHICLYYRDILVKELTTTSPEGCRISHGHTYDVSNLDQVLFPYPDDNGQRKNIEKLLSHLERGLVLWMAPDGLYAKRLCQSRIYWDGPLALCSDRPNKLERDQTCKLFDTQQFLSELQVFAHHGRPAPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNTGHFLRGYELPEHVTTPDYHRSLRHSSIQE
Sequence Length
450
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,449 Da
NCBI Official Full Name
interferon regulatory factor 4 isoform b
NCBI Official Synonym Full Names
interferon regulatory factor 4
NCBI Official Symbol
Irf4
NCBI Official Synonym Symbols
Spip; IRF-4; LSIRF; NF-EM5; AI385587
NCBI Protein Information
interferon regulatory factor 4
UniProt Protein Name
Interferon regulatory factor 4
Protein Family
UniProt Gene Name
Irf4
UniProt Synonym Gene Names
Spip; IRF-4; LSIRF
Uniprot Description
Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Involved in CD8+ dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 and activation of genes.
Research Articles on Irf4
Similar Products
Product Notes
The Irf4 irf4 (Catalog #AAA1456954) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-450, full length protein. The amino acid sequence is listed below: MNLETGSRGS EFGMSAVSCG NGKLRQWLID QIDSGKYPGL VWENEEKSVF RIPWKHAGKQ DYNREEDAAL FKAWALFKGK FREGIDKPDP PTWKTRLRCA LNKSNDFEEL VERSQLDISD PYKVYRIVPE GAKKGAKQLT LDDTQMAMGH PYPMTAPYGS LPAQQVHNYM MPPHDRSWRD YAPDQSHPEI PYQCPVTFGP RGHHWQGPSC ENGCQVTGTF YACAPPESQA PGIPIEPSIR SAEALALSDC RLHICLYYRD ILVKELTTTS PEGCRISHGH TYDVSNLDQV LFPYPDDNGQ RKNIEKLLSH LERGLVLWMA PDGLYAKRLC QSRIYWDGPL ALCSDRPNKL ERDQTCKLFD TQQFLSELQV FAHHGRPAPR FQVTLCFGEE FPDPQRQRKL ITAHVEPLLA RQLYYFAQQN TGHFLRGYEL PEHVTTPDYH RSLRHSSIQE. It is sometimes possible for the material contained within the vial of "Interferon regulatory factor 4 (Irf4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
