Peptidyl-tRNA hydrolase ICT1, mitochondrial (Ict1) Recombinant Protein | Ict1 recombinant protein
Recombinant Mouse Peptidyl-tRNA hydrolase ICT1, mitochondrial (Ict1)
Gene Names
Mrpl58; Ict1; MRP-L58; 1110001A02Rik; 1110002E03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptidyl-tRNA hydrolase ICT1; mitochondrial (Ict1); Recombinant Mouse Peptidyl-tRNA hydrolase ICT1; Ict1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-206, full length protein
Sequence
LHRQVDGTTFQSIYSLDKLYPESKGADTAWKVPEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLRIEKMNRERLRQKRLNSALKTSRRMTMD
Sequence Length
177
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ict1 recombinant protein
The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,277 Da
NCBI Official Full Name
peptidyl-tRNA hydrolase ICT1, mitochondrial isoform 2
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L58
NCBI Official Symbol
Mrpl58
NCBI Official Synonym Symbols
Ict1; MRP-L58; 1110001A02Rik; 1110002E03Rik
NCBI Protein Information
peptidyl-tRNA hydrolase ICT1, mitochondrial
UniProt Protein Name
Peptidyl-tRNA hydrolase ICT1, mitochondrial
Protein Family
UniProt Gene Name
Mrpl58
UniProt Synonym Gene Names
MRP-L58
Uniprot Description
Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit (PubMed:20869366). Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes ().
Research Articles on Ict1
Similar Products
Product Notes
The Ict1 mrpl58 (Catalog #AAA1373779) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-206, full length protein. The amino acid sequence is listed below: LHRQVDGTTF QSIYSLDKLY PESKGADTAW KVPEHAKQAS SYIPLDRLSI SYCRSSGPGG QNVNKVNSKA EVRFHLASAD WIEEPVRQKI ALTHKNKINK AGELVLTSES SRYQFRNLAE CLQKIRDMIA EASQVPKEPS KEDARLQRLR IEKMNRERLR QKRLNSALKT SRRMTMD. It is sometimes possible for the material contained within the vial of "Peptidyl-tRNA hydrolase ICT1, mitochondrial (Ict1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
