Microtubule-associated protein RP/EB family member 1 (MAPRE1) Recombinant Protein | MAPRE1 recombinant protein
Recombinant Chicken Microtubule-associated protein RP/EB family member 1 (MAPRE1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Microtubule-associated protein RP/EB family member 1 (MAPRE1); Recombinant Chicken Microtubule-associated protein RP/EB family member 1 (MAPRE1); MAPRE1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-258, Full length protein
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLTLTKIEQLCSGAAYCQFMDMLFPGSVALKKVKFQAKLEHEYIQNFKVLQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQGQETVAPNLVAPVVNKPKKPLAPQRPIVAQRTPATPKGSTGMVKKAAGDDESAGLIEQINVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVEILYATDEGFVIPDEGAPQEEQEEY
Sequence Length
258
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MAPRE1 recombinant protein
This protein was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP
EB family.
EB family.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,143 Da
NCBI Official Full Name
microtubule-associated protein RP/EB family member 1
NCBI Official Synonym Full Names
microtubule associated protein RP/EB family member 1
NCBI Official Symbol
MAPRE1
NCBI Protein Information
microtubule-associated protein RP/EB family member 1
UniProt Protein Name
Microtubule-associated protein RP/EB family member 1
Protein Family
UniProt Gene Name
MAPRE1
Uniprot Description
Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes.
Similar Products
Product Notes
The MAPRE1 mapre1 (Catalog #AAA1364574) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-258, Full length protein. The amino acid sequence is listed below: MAVNVYSTSV TSDNLSRHDM LAWINESLQL TLTKIEQLCS GAAYCQFMDM LFPGSVALKK VKFQAKLEHE YIQNFKVLQA GFKRMGVDKI IPVDKLVKGK FQDNFEFVQW FKKFFDANYD GKEYDPVAAR QGQETVAPNL VAPVVNKPKK PLAPQRPIVA QRTPATPKGS TGMVKKAAGD DESAGLIEQI NVLKLTVEDL EKERDFYFGK LRNIELICQE NEGENDPVLQ RIVEILYATD EGFVIPDEGA PQEEQEEY. It is sometimes possible for the material contained within the vial of "Microtubule-associated protein RP/EB family member 1 (MAPRE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
