WAP four-disulfide core domain protein 1 (WFDC1) Recombinant Protein | WFDC1 recombinant protein
Recombinant Chicken WAP four-disulfide core domain protein 1 (WFDC1)
Gene Names
WFDC1; PS20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
WAP four-disulfide core domain protein 1 (WFDC1); Recombinant Chicken WAP four-disulfide core domain protein 1 (WFDC1); WFDC1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-222, Full length protein
Sequence
RNLWKRALHLKMTEKYDDYEYPLHSHSAHYQKNDRCPPPPQTLPDRACEVPSCRSDSECERHKRCCYNGCIYACLESVQPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGDEPLHCPTGYECHIINPGNTAEGIPNRGQCIKLRGNPDGRNLRHKYYKEYFGSNSNNVVGYVKNQQKHLG
Sequence Length
190
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for WFDC1 recombinant protein
This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,236 Da
NCBI Official Full Name
WAP four-disulfide core domain protein 1
NCBI Official Synonym Full Names
WAP four-disulfide core domain 1
NCBI Official Symbol
WFDC1
NCBI Official Synonym Symbols
PS20
NCBI Protein Information
WAP four-disulfide core domain protein 1
UniProt Protein Name
WAP four-disulfide core domain protein 1
Protein Family
UniProt Gene Name
WFDC1
UniProt Synonym Gene Names
PS20
Uniprot Description
Has growth inhibitory activity.
Similar Products
Product Notes
The WFDC1 wfdc1 (Catalog #AAA1330417) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-222, Full length protein. The amino acid sequence is listed below: RNLWKRALHL KMTEKYDDYE YPLHSHSAHY QKNDRCPPPP QTLPDRACEV PSCRSDSECE RHKRCCYNGC IYACLESVQP PPVLDWLVQP KPRWLGGNGW LLDGPEEVLQ AEACSTTEDG DEPLHCPTGY ECHIINPGNT AEGIPNRGQC IKLRGNPDGR NLRHKYYKEY FGSNSNNVVG YVKNQQKHLG. It is sometimes possible for the material contained within the vial of "WAP four-disulfide core domain protein 1 (WFDC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
