Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C4b-binding protein beta chain (C4bpb) Recombinant Protein | C4bpb recombinant protein

Recombinant Rat C4b-binding protein beta chain (C4bpb)

Gene Names
C4bpb; C4bp-ps1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C4b-binding protein beta chain (C4bpb); Recombinant Rat C4b-binding protein beta chain (C4bpb); C4bpb recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-258, full length protein
Sequence
LDGSCSEPPPVNNSVFVGKETEEQILGIYLCIKGYHLVGKKSLVFDPSKEWNSTLPECLLGHCPDPVLENGKINSSGPVNISGKIMFECNDGYILKGSNWSQCLEDHTWAPPLPICRSRDCEPPETPVHGYFEGETFTSGSVVTYYCEDGYHLVGTQKVQCSDGEWSPSYPTCESIQEPPKSAEQSALEKAILAFQESKDLCNATENFVRQLREGGITMEELKCSLEMKKTKLKSDILLNYHS
Sequence Length
243
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for C4bpb recombinant protein
This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
28,642 Da
NCBI Official Full Name
C4b-binding protein beta chain
NCBI Official Synonym Full Names
complement component 4 binding protein, beta
NCBI Official Symbol
C4bpb
NCBI Official Synonym Symbols
C4bp-ps1
NCBI Protein Information
C4b-binding protein beta chain
UniProt Protein Name
C4b-binding protein beta chain
Protein Family
UniProt Gene Name
C4bpb

NCBI Description

putative complement binding protein; human homolog involved in regulation of complement cascade of innate immune response [RGD, Feb 2006]

Uniprot Description

Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It interacts also with anticoagulant protein S and with serum amyloid P component.

Similar Products

Product Notes

The C4bpb c4bpb (Catalog #AAA1302739) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-258, full length protein. The amino acid sequence is listed below: LDGSCSEPPP VNNSVFVGKE TEEQILGIYL CIKGYHLVGK KSLVFDPSKE WNSTLPECLL GHCPDPVLEN GKINSSGPVN ISGKIMFECN DGYILKGSNW SQCLEDHTWA PPLPICRSRD CEPPETPVHG YFEGETFTSG SVVTYYCEDG YHLVGTQKVQ CSDGEWSPSY PTCESIQEPP KSAEQSALEK AILAFQESKD LCNATENFVR QLREGGITME ELKCSLEMKK TKLKSDILLN YHS. It is sometimes possible for the material contained within the vial of "C4b-binding protein beta chain (C4bpb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.