Pre-mRNA branch site protein p14 (Sf3b14) Recombinant Protein | Sf3b14 recombinant protein
Recombinant Mouse Pre-mRNA branch site protein p14 (Sf3b14)
Gene Names
Sf3b6; Sf3b14; AV001342; 0610009D07Rik; 6030419K15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pre-mRNA branch site protein p14 (Sf3b14); Recombinant Mouse Pre-mRNA branch site protein p14 (Sf3b14); Sf3b14 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-125, full length protein
Sequence
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Sequence Length
125
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,585 Da
NCBI Official Full Name
splicing factor 3B subunit 6
NCBI Official Synonym Full Names
splicing factor 3B, subunit 6
NCBI Official Symbol
Sf3b6
NCBI Official Synonym Symbols
Sf3b14; AV001342; 0610009D07Rik; 6030419K15Rik
NCBI Protein Information
splicing factor 3B subunit 6
UniProt Protein Name
Splicing factor 3B subunit 6
UniProt Gene Name
Sf3b6
UniProt Synonym Gene Names
Sf3b14
Uniprot Description
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Directly contacts the pre-mRNA branch site adenosine for the first catalytic step of splicing. Enters the spliceosome and associates with the pre-mRNA branch site as part of the 17S U2 or, in the case of the minor spliceosome, as part of the 18S U11/U12 snRNP complex, and thus may facilitate the interaction of these snRNP with the branch sites of U2 and U12 respectively.
Research Articles on Sf3b14
Similar Products
Product Notes
The Sf3b14 sf3b6 (Catalog #AAA1257822) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-125, full length protein. The amino acid sequence is listed below: MAMQAAKRAN IRLPPEVNRI LYIRNLPYKI TAEEMYDIFG KYGPIRQIRV GNTPETRGTA YVVYEDIFDA KNACDHLSGF NVCNRYLVVL YYNANRAFQK MDTKKKEEQL KLLKEKYGIN TDPPK. It is sometimes possible for the material contained within the vial of "Pre-mRNA branch site protein p14 (Sf3b14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
