Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Hemoglobin subunit beta-1 (Hbb-b1) Recombinant Protein | Hbb-b1 recombinant protein

Recombinant Mouse Hemoglobin subunit beta-1 (Hbb-b1)

Gene Names
Hbb-bs; Hbbt1; Hbbt2; Beta-s
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemoglobin subunit beta-1 (Hbb-b1); Recombinant Mouse Hemoglobin subunit beta-1 (Hbb-b1); Hbb-b1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-147, full length protein
Sequence
VHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
Sequence Length
146
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,840 Da
NCBI Official Full Name
hemoglobin, beta adult s chain
NCBI Official Synonym Full Names
hemoglobin, beta adult s chain
NCBI Official Symbol
Hbb-bs
NCBI Official Synonym Symbols
Hbbt1; Hbbt2; Beta-s
NCBI Protein Information
hemoglobin, beta adult s chain
UniProt Protein Name
Hemoglobin subunit beta-1
UniProt Gene Name
Hbb-b1

NCBI Description

This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta s adult gene found in the "single" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1. [provided by RefSeq, May 2013]

Uniprot Description

Involved in oxygen transport from the lung to the various peripheral tissues.

Research Articles on Hbb-b1

Similar Products

Product Notes

The Hbb-b1 hbb-b1 (Catalog #AAA1230496) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-147, full length protein. The amino acid sequence is listed below: VHLTDAEKAA VSCLWGKVNS DEVGGEALGR LLVVYPWTQR YFDSFGDLSS ASAIMGNAKV KAHGKKVITA FNDGLNHLDS LKGTFASLSE LHCDKLHVDP ENFRLLGNMI VIVLGHHLGK DFTPAAQAAF QKVVAGVATA LAHKYH. It is sometimes possible for the material contained within the vial of "Hemoglobin subunit beta-1 (Hbb-b1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.