Glycine/sarcosine/betaine reductase complex component A (grdA) Recombinant Protein | grdA recombinant protein
Recombinant Clostridium botulinum Glycine/sarcosine/betaine reductase complex component A (grdA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycine/sarcosine/betaine reductase complex component A (grdA); Recombinant Clostridium botulinum Glycine/sarcosine/betaine reductase complex component A (grdA); grdA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-158, Full length protein
Sequence
MSLFEGKKVIIIGDRDGIPGPAIEKCIEGTGAEVVFSSTECFVUTAAGAMDLENQKRVKTLTEKHGAENILVILGAAEGEAAGLAAETVTNGDPTFAGPLSNVQLGLRVYHAVEPEFKEEVNEEVYEEEIGMMEMVLEVDEIIEEMTDIRTEFCKFLD
Sequence Length
158
Species
Clostridium botulinum (strain ATCC 19397 / Type A)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
17,221 Da
NCBI Official Full Name
Glycine/sarcosine/betaine reductase complex component A
UniProt Protein Name
Glycine/sarcosine/betaine reductase complex component A
Protein Family
UniProt Gene Name
grdA
Uniprot Description
In the first step of glycine, betaine and sarcosine reductases, the substrate is bound to component PB via a Schiff base intermediate. Then the PB-activated substrate is nucleophilically attacked by the selenol anion of component PA to transform it to a carboxymethylated selenoether and the respective amine. By action of component PC, acetyl phosphate is formed, leaving component PA in its oxidized state. Finally component PA becomes reduced by the thioredoxin system to start a new catalytic cycle of reductive deamination.
Similar Products
Product Notes
The grdA grda (Catalog #AAA1210569) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-158, Full length protein. The amino acid sequence is listed below: MSLFEGKKVI IIGDRDGIPG PAIEKCIEGT GAEVVFSSTE CFVUTAAGAM DLENQKRVKT LTEKHGAENI LVILGAAEGE AAGLAAETVT NGDPTFAGPL SNVQLGLRVY HAVEPEFKEE VNEEVYEEEI GMMEMVLEVD EIIEEMTDIR TEFCKFLD. It is sometimes possible for the material contained within the vial of "Glycine/sarcosine/betaine reductase complex component A (grdA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
